PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cotton_A_25264_BGI-A2_v1.0 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 207aa MW: 23349.6 Da PI: 8.2673 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.9 | 1.7e-16 | 14 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd +l+ +++ +G+g +W + ++++g++R++k+c++rw++yl Cotton_A_25264_BGI-A2_v1.0 14 KGPWSPEEDAKLKAYIEHYGTGgNWISLPQKIGLKRCGKSCRLRWLNYL 62 79*********************************************97 PP | |||||||
2 | Myb_DNA-binding | 40.4 | 6.6e-13 | 69 | 111 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 g +++eEde++ + G++ W+ Ia+ ++ gRt++++k++w++ Cotton_A_25264_BGI-A2_v1.0 69 GGFSEEEDEIICSLYVSIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111 569******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.275 | 9 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.21E-27 | 11 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.3E-12 | 13 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.1E-15 | 14 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.3E-25 | 15 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.89E-10 | 16 | 62 | No hit | No description |
PROSITE profile | PS51294 | 22.071 | 63 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 2.9E-11 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.7E-11 | 69 | 111 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.6E-24 | 70 | 117 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.03E-8 | 71 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 207 aa Download sequence Send to blast |
MGRAPCCDKA NVKKGPWSPE EDAKLKAYIE HYGTGGNWIS LPQKIGLKRC GKSCRLRWLN 60 YLRPNIKHGG FSEEEDEIIC SLYVSIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGR 120 YPRPEPPFPV VPVPYSSQGQ SIQFTNSQCS VVDGANMEQH MLQGQTSSSS LNGMELLYGE 180 DIINDTSSLV CLGMFQHYAF YDHISLQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-26 | 14 | 117 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factors that activates genes required for endodermal differentiation but represses genes involved in proliferative divisions, thus regulating the transition from proliferation to differentiation in root endodermis (PubMed:26371322). Required for Casparian strip formation by positively regulating the expression of the Casparian strip genes CASP1, PER64 and ESB1 and other endodermis-specific genes, thus triggering correct localized lignin biosynthesis in root endodermis and subsequently regulating global ion homeostasis (PubMed:26124109, PubMed:26371322). {ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Directly up-regulated by SCARECROW (SCR), as part of the differentiation program controlled by SHORT-ROOT (SHR). {ECO:0000269|PubMed:24517883, ECO:0000269|PubMed:26371322}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM052724 | 0.0 | KM052724.1 Gossypium hirsutum RAX-like transcription factor RAX5 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017645309.1 | 1e-155 | PREDICTED: transcription factor MYB36-like | ||||
Swissprot | Q9FKL2 | 5e-80 | MYB36_ARATH; Transcription factor MYB36 | ||||
TrEMBL | A0A1U8LT14 | 1e-151 | A0A1U8LT14_GOSHI; transcription factor RAX3-like | ||||
STRING | Gorai.010G028800.1 | 1e-138 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G57620.1 | 5e-83 | myb domain protein 36 |
Publications ? help Back to Top | |||
---|---|---|---|
|