PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cotton_A_22387_BGI-A2_v1.0 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 136aa MW: 15315.1 Da PI: 5.3332 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 161.1 | 1.6e-50 | 3 | 98 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 eq+r+lPianv+rimk++lP ak+sk+ak+t+qec++efisfvt+easdkc++e+rkt+ngdd++wal+ lGf++y++++ y Cotton_A_22387_BGI-A2_v1.0 3 DEQERLLPIANVGRIMKQILPPSAKVSKEAKQTLQECATEFISFVTGEASDKCRKENRKTVNGDDICWALGALGFDNYADAIVRY 87 69*********************************************************************************** PP NF-YB 87 lkkyrelegek 97 l+kyre+e++k Cotton_A_22387_BGI-A2_v1.0 88 LHKYREVERDK 98 *********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.2E-49 | 2 | 128 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.48E-38 | 5 | 124 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.5E-25 | 8 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.9E-16 | 36 | 54 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 39 | 55 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 4.9E-16 | 55 | 73 | No hit | No description |
PRINTS | PR00615 | 4.9E-16 | 74 | 92 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 136 aa Download sequence Send to blast |
MVDEQERLLP IANVGRIMKQ ILPPSAKVSK EAKQTLQECA TEFISFVTGE ASDKCRKENR 60 KTVNGDDICW ALGALGFDNY ADAIVRYLHK YREVERDKAT QNKATCISSQ EKDEESSEEK 120 SNQPPHQQAE APSTRV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-39 | 2 | 93 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-39 | 2 | 93 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00133 | DAP | Transfer from AT1G09030 | Download |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ567167 | 9e-54 | AJ567167.1 Gossypium hirsutum microsatellite DNA mGhCIR221, clone CIR221. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017618953.1 | 1e-98 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | O04027 | 3e-56 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A1U8I387 | 4e-95 | A0A1U8I387_GOSHI; nuclear transcription factor Y subunit B-4-like | ||||
TrEMBL | A0A1U8IBA1 | 4e-95 | A0A1U8IBA1_GOSHI; nuclear transcription factor Y subunit B-4-like | ||||
STRING | Gorai.013G205200.1 | 1e-95 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09030.1 | 2e-56 | nuclear factor Y, subunit B4 |
Publications ? help Back to Top | |||
---|---|---|---|
|