PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cotton_A_15785_BGI-A2_v1.0 | ||||||||
Common Name | F383_29971 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 198aa MW: 22848.4 Da PI: 4.5977 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 125.3 | 5.1e-39 | 9 | 127 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyW 83 lppGfrF Ptdeelvv++L++k++ +++ +vi+++++y ++Pw+L+ k+ +e ++wyf+s+r +nr+t +gyW Cotton_A_15785_BGI-A2_v1.0 9 LPPGFRFYPTDEELVVHFLQRKAALLPCHP-DVIPDLELYPHDPWELDGKALGEGNQWYFYSRRT--------QNRITGNGYW 82 79*************************999.99**************977778899******984........589******* PP NAM 84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 k g +++v+++++++vg+kk Lvfy g+ p + kt+W+m+eyrl Cotton_A_15785_BGI-A2_v1.0 83 KPMGIEEDVINSRSKKVGMKKYLVFYIGEGPAAIKTNWIMQEYRL 127 *******************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.01E-48 | 6 | 158 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 45.451 | 9 | 159 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.2E-23 | 10 | 127 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 198 aa Download sequence Send to blast |
MGENSSVNLP PGFRFYPTDE ELVVHFLQRK AALLPCHPDV IPDLELYPHD PWELDGKALG 60 EGNQWYFYSR RTQNRITGNG YWKPMGIEED VINSRSKKVG MKKYLVFYIG EGPAAIKTNW 120 IMQEYRLSKS DSSSTKSSKR RGHSRVDYSK WVVCRVYERN CSEDEDDGDD DDDGTQLSCL 180 DEVFLSLDDM DEISLPFN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 5e-44 | 5 | 165 | 13 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 5e-44 | 5 | 165 | 13 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 5e-44 | 5 | 165 | 13 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 5e-44 | 5 | 165 | 13 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 5e-44 | 5 | 165 | 16 | 174 | NAC domain-containing protein 19 |
3swm_B | 5e-44 | 5 | 165 | 16 | 174 | NAC domain-containing protein 19 |
3swm_C | 5e-44 | 5 | 165 | 16 | 174 | NAC domain-containing protein 19 |
3swm_D | 5e-44 | 5 | 165 | 16 | 174 | NAC domain-containing protein 19 |
3swp_A | 5e-44 | 5 | 165 | 16 | 174 | NAC domain-containing protein 19 |
3swp_B | 5e-44 | 5 | 165 | 16 | 174 | NAC domain-containing protein 19 |
3swp_C | 5e-44 | 5 | 165 | 16 | 174 | NAC domain-containing protein 19 |
3swp_D | 5e-44 | 5 | 165 | 16 | 174 | NAC domain-containing protein 19 |
4dul_A | 5e-44 | 5 | 165 | 13 | 171 | NAC domain-containing protein 19 |
4dul_B | 5e-44 | 5 | 165 | 13 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC847241 | 0.0 | KC847241.1 Gossypium hirsutum NAC domain protein NAC64 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017636481.1 | 1e-147 | PREDICTED: NAC domain-containing protein 104-like | ||||
Swissprot | Q8GWK6 | 2e-85 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | A0A0B0MUI1 | 1e-146 | A0A0B0MUI1_GOSAR; NAC domain-containing 19-like protein | ||||
STRING | Gorai.008G014700.1 | 1e-144 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3674 | 28 | 62 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 3e-80 | xylem NAC domain 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|