PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cotton_A_06748_BGI-A2_v1.0 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 91aa MW: 10461 Da PI: 10.2863 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 63.2 | 5.1e-20 | 17 | 64 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd++l+d+++++G g W+t ++ g++R++k+c++rw +yl Cotton_A_06748_BGI-A2_v1.0 17 RGPWTAEEDKILIDYIQKHGHGKWRTLPKNAGLKRCGKSCRLRWANYL 64 89********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 5.5E-26 | 12 | 67 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 23.771 | 12 | 68 | IPR017930 | Myb domain |
SMART | SM00717 | 6.8E-15 | 16 | 66 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.1E-17 | 17 | 64 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 8.59E-25 | 18 | 91 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.00E-11 | 19 | 64 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 7.1E-9 | 68 | 91 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 8.509 | 69 | 91 | IPR017930 | Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 91 aa Download sequence Send to blast |
MGKQPACSSD KNGELKRGPW TAEEDKILID YIQKHGHGKW RTLPKNAGLK RCGKSCRLRW 60 ANYLRPDIKR GKFSDEEEQT IIQLHSVLGN K |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-18 | 12 | 91 | 22 | 100 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017625632.1 | 8e-62 | PREDICTED: transcription factor MYB39-like | ||||
Swissprot | Q9LDR8 | 8e-47 | MY102_ARATH; Transcription factor MYB102 | ||||
TrEMBL | A0A1U8LGH1 | 3e-59 | A0A1U8LGH1_GOSHI; transcription factor MYB39-like | ||||
STRING | Gorai.004G029000.1 | 1e-58 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G21440.1 | 3e-49 | MYB-like 102 |
Publications ? help Back to Top | |||
---|---|---|---|
|