PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna26009.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family ZF-HD
Protein Properties Length: 143aa    MW: 15687.6 Da    PI: 8.3773
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna26009.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer106.51.5e-332884360
              ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                             +vrY eC+kNhAa++Gg+avDGC+Efm+s ge+gta+al+CaACgCHRnFHRrev++e
  mrna26009.1-v1.0-hybrid 28 TVRYGECQKNHAANIGGYAVDGCREFMAS-GEDGTAEALTCAACGCHRNFHRREVDTE 84
                             79**************************9.999*********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047704.2E-312981IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.2E-273081IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-243188IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.3993180IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MKKQQVVVRR DGSSRRSSSS TSSSVVRTVR YGECQKNHAA NIGGYAVDGC REFMASGEDG  60
TAEALTCAAC GCHRNFHRRE VDTEVVCDVK IISFKQSSVL QHQAPKPYNE HLFQQELAKY  120
EGHGVAAVEA YSLHVRLPPL AY*
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna26009.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024173860.11e-46mini zinc finger protein 3-like
SwissprotQ9LJW56e-37MIF2_ARATH; Mini zinc finger protein 2
TrEMBLA0A2P6P2L12e-45A0A2P6P2L1_ROSCH; Putative transcription factor ZF-HD family
STRINGXP_004299362.13e-57(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF155034100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.13e-33mini zinc finger 1
Publications ? help Back to Top
  1. Bollier N, et al.
    At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato.
    Plant Cell, 2018. 30(1): p. 83-100
    [PMID:29298836]