PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | mrna26009.1-v1.0-hybrid | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 143aa MW: 15687.6 Da PI: 8.3773 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 106.5 | 1.5e-33 | 28 | 84 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +vrY eC+kNhAa++Gg+avDGC+Efm+s ge+gta+al+CaACgCHRnFHRrev++e mrna26009.1-v1.0-hybrid 28 TVRYGECQKNHAANIGGYAVDGCREFMAS-GEDGTAEALTCAACGCHRNFHRREVDTE 84 79**************************9.999*********************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04770 | 4.2E-31 | 29 | 81 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 1.2E-27 | 30 | 81 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
ProDom | PD125774 | 3.0E-24 | 31 | 88 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 26.399 | 31 | 80 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MKKQQVVVRR DGSSRRSSSS TSSSVVRTVR YGECQKNHAA NIGGYAVDGC REFMASGEDG 60 TAEALTCAAC GCHRNFHRRE VDTEVVCDVK IISFKQSSVL QHQAPKPYNE HLFQQELAKY 120 EGHGVAAVEA YSLHVRLPPL AY* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | mrna26009.1-v1.0-hybrid |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024173860.1 | 1e-46 | mini zinc finger protein 3-like | ||||
Swissprot | Q9LJW5 | 6e-37 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
TrEMBL | A0A2P6P2L1 | 2e-45 | A0A2P6P2L1_ROSCH; Putative transcription factor ZF-HD family | ||||
STRING | XP_004299362.1 | 3e-57 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1550 | 34 | 100 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G74660.1 | 3e-33 | mini zinc finger 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | mrna26009.1-v1.0-hybrid |
Publications ? help Back to Top | |||
---|---|---|---|
|