PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna25651.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family GATA
Protein Properties Length: 336aa    MW: 36761.4 Da    PI: 6.5709
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna25651.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA529.3e-17227261135
                     GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                              C +C + kTp+WR gp g+ktLCnaCG++y++ +l
  mrna25651.1-v1.0-hybrid 227 CLHCASEKTPQWRTGPMGPKTLCNACGVRYKSGRL 261
                              99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169929.7E-8419310IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011412.334221257IPR000679Zinc finger, GATA-type
SMARTSM004014.5E-17221271IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.105.1E-14222258IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577161.76E-14222284No hitNo description
CDDcd002022.52E-13226273No hitNo description
PROSITE patternPS003440227252IPR000679Zinc finger, GATA-type
PfamPF003201.2E-14227261IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MELPELYVGG YFDDHLSPEK RQLVDQKPPA GGEQFTIDDL LDFSNEDALV TDGFFDSAVA  60
GNSTDSSTVT AVDSCNSSVS GGEPQFSGNR SFGDSQFSGD LCVPYDDLAE LEWLSNFVED  120
SFSADKDLQA LQFLSTTTAT AKPQTPETSS SAETPQNPPL FHNETPLPGK ARSKRSRAAP  180
GDWTTRLLHL ITPSNNTDPK PPKTTSSQKK REGASSNSGS DSSGRKCLHC ASEKTPQWRT  240
GPMGPKTLCN ACGVRYKSGR LVPEYRPAAS PTFVSARHSN SHRKVLELRR QKEFQRSHQH  300
QFLSPTSIFG VSNGGDEFLI HHHHHRGAND FRQMM*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00048PBMTransfer from AT4G32890Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna25651.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004302868.20.0PREDICTED: GATA transcription factor 9-like
TrEMBLA0A2P6RXA40.0A0A2P6RXA4_ROSCH; GATA transcription factor
STRINGXP_004302868.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13643395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.13e-76GATA transcription factor 9