PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT4G32890.1 | ||||||||
Common Name | F26P21.10, GATA9 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 308aa MW: 34346.2 Da PI: 4.9266 | ||||||||
Description | GATA transcription factor 9 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 54.5 | 1.6e-17 | 199 | 233 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C +C t kTp+WR gp g+ktLCnaCG++y++ +l AT4G32890.1 199 CLHCATEKTPQWRTGPMGPKTLCNACGVRYKSGRL 233 99*****************************9885 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF016992 | 1.4E-113 | 1 | 289 | IPR016679 | Transcription factor, GATA, plant |
PROSITE profile | PS50114 | 12.255 | 193 | 229 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 1.7E-17 | 193 | 243 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 1.24E-15 | 195 | 257 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 1.8E-14 | 195 | 231 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 1.07E-14 | 198 | 245 | No hit | No description |
PROSITE pattern | PS00344 | 0 | 199 | 224 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 2.6E-15 | 199 | 233 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007623 | Biological Process | circadian rhythm | ||||
GO:0009416 | Biological Process | response to light stimulus | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0045944 | Biological Process | positive regulation of transcription from RNA polymerase II promoter | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005667 | Cellular Component | transcription factor complex | ||||
GO:0000977 | Molecular Function | RNA polymerase II regulatory region sequence-specific DNA binding | ||||
GO:0001085 | Molecular Function | RNA polymerase II transcription factor binding | ||||
GO:0001228 | Molecular Function | transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding | ||||
GO:0003682 | Molecular Function | chromatin binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0009005 | anatomy | root | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 308 aa Download sequence Send to blast |
MEKIAPELFL VAGNPDSFVV DDLLDFSNDD GEVDDGLNTL PDSSTLSTGT LTDSSNSSSL 60 FTDGTGFSDL YIPNDDIAEL EWLSNFVEES FAGEDQDKLH LFSGLKNPQT TGSTLTHLIK 120 PEPELDHQFI DIDESNVAVP AKARSKRSRS AASTWASRLL SLADSDETNP KKKQRRVKEQ 180 DFAGDMDVDC GESGGGRRCL HCATEKTPQW RTGPMGPKTL CNACGVRYKS GRLVPEYRPA 240 SSPTFVMARH SNSHRKVMEL RRQKEMRDEH LLSQLRCENL LMDIRSNGED FLMHNNTNHV 300 APDFRHLI |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 169 | 175 | PKKKQRR |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.2468 | 0.0 | bud |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 30689533 | 0.0 | ||||
Genevisible | 253406_at | 0.0 | ||||
Expression Atlas | AT4G32890 | - | ||||
AtGenExpress | AT4G32890 | - | ||||
ATTED-II | AT4G32890 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Encodes a member of the GATA factor family of zinc finger transcription factors. | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00048 | PBM | 25215497 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT4G32890.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT4G32890 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK117169 | 0.0 | AK117169.1 Arabidopsis thaliana At4g32890 mRNA for unknown protein, complete cds, clone: RAFL16-71-E16. | |||
GenBank | BT008342 | 0.0 | BT008342.1 Arabidopsis thaliana At4g32890 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_195015.1 | 0.0 | GATA transcription factor 9 | ||||
Swissprot | O82632 | 0.0 | GATA9_ARATH; GATA transcription factor 9 | ||||
TrEMBL | A0A178V5R8 | 0.0 | A0A178V5R8_ARATH; GATA transcription factor | ||||
STRING | AT4G32890.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5682 | 27 | 49 | Representative plant | OGRP68 | 17 | 287 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT4G32890.1 |
Entrez Gene | 829425 |
iHOP | AT4G32890 |
wikigenes | AT4G32890 |