PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | mrna17738.1-v1.0-hybrid | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 179aa MW: 20454 Da PI: 9.8265 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 134 | 5e-42 | 56 | 131 | 1 | 76 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 +Cq+++C+adls+ak yhrrhkvC++hskapvvlvsg++qrfCqqCsrfhelsefD++krsCrrrLa+hnerrrk+ mrna17738.1-v1.0-hybrid 56 CCQADKCTADLSDAKLYHRRHKVCDQHSKAPVVLVSGISQRFCQQCSRFHELSEFDDTKRSCRRRLAGHNERRRKN 131 6*************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 4.0E-33 | 49 | 118 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 31.795 | 54 | 131 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 5.62E-38 | 55 | 134 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 8.1E-33 | 57 | 130 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0007010 | developmental stage | whole plant fruit ripening stage | ||||
PO:0007027 | developmental stage | whole plant fruit formation stage 70% to final size |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MAESKSKQRK ENPHAVVKKE EEEEDHEDLD NKKKKLQVVG GCGSGSVKNQ NQMMRCCQAD 60 KCTADLSDAK LYHRRHKVCD QHSKAPVVLV SGISQRFCQQ CSRFHELSEF DDTKRSCRRR 120 LAGHNERRRK NLSETYAGGS SRKGTSTESC RRVEDMGSGR IQINIQEMST RNKHFQIR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 6e-38 | 54 | 130 | 8 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00634 | PBM | Transfer from PK22320.1 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | mrna17738.1-v1.0-hybrid |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040, ECO:0000305|PubMed:16914499}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004303145.1 | 1e-129 | PREDICTED: squamosa promoter-binding protein 1-like | ||||
Swissprot | Q9S7A9 | 1e-42 | SPL4_ARATH; Squamosa promoter-binding-like protein 4 | ||||
TrEMBL | A0A2P6RU29 | 7e-82 | A0A2P6RU29_ROSCH; Putative transcription factor SBP family | ||||
STRING | XP_004303145.1 | 1e-129 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF535 | 34 | 153 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G53160.2 | 7e-45 | squamosa promoter binding protein-like 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | mrna17738.1-v1.0-hybrid |