PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna16150.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family GATA
Protein Properties Length: 831aa    MW: 92327.6 Da    PI: 9.2325
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna16150.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.35e-19408441134
                     GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                              C++C +tkTp+WR+gp g+ktLCnaCG++yr+ +
  mrna16150.1-v1.0-hybrid 408 CTHCAVTKTPQWREGPLGPKTLCNACGVRYRSGR 441
                              *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.268402438IPR000679Zinc finger, GATA-type
SMARTSM004013.2E-16402452IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.09E-14404465No hitNo description
Gene3DG3DSA:3.30.50.102.3E-13406439IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.52E-15407464No hitNo description
PfamPF003206.6E-17408441IPR000679Zinc finger, GATA-type
PROSITE patternPS003440408433IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007027developmental stagewhole plant fruit formation stage 70% to final size
Sequence ? help Back to Top
Protein Sequence    Length: 831 aa     Download sequence    Send to blast
MTTASTRWNL DRSAHHRRMT FVITVSNLYE TMRLIGEGVA GEDKALIGGS KEAPSRRRTT  60
SLELVGPCRS GSTLRRCNQG RAGSRVETAA ALSSRHKSHR ESHLLLLLLL FSLRTTTTSL  120
SLLTKTMTAV SADVTKLPKR EVLDCLFELV YIYHRVVLVA CLHHILTVSF FASFVKSILS  180
LKQSTTMDAL PLDDNINQLL EHFYDDDTIK ALDFPMEDID ATDEDWKTQL QGLEPYYESS  240
FQYLSTSYEG TSGVTAITTS GRSSLQSNDF FDQKHMHLIP THSPVSVLKS QSESQSSGSA  300
QHLRPLEPNF MNIRAPEPSF VNPVKKKRTQ CRRARPANFS HRFTFPCVSS NSSVSDNFYR  360
FETFLTEEML NPDKRRQKKK NPSFQETGEI SETKRCVEPG ENRETKRCTH CAVTKTPQWR  420
EGPLGPKTLC NACGVRYRSG RLFPEYRPAA SPTFVPAVHS NSHKKPTPLE KSVATQILLC  480
RWSSSRNRPK FQFGLTGAEA GGGRGHNLCE VSNLAILVRF GQRRGCMTVV KIQGLSPALF  540
ADVIAKVVGE TIGLVLHVKQ AGIRCGGAQF KYECLFDRYK ECEMNFVHLL GIVEESLSFP  600
LSSCKNPSFG NCFRGRECSF GIPGDHKYEN QDDTYSYSTS LPLSFSLLPP SSPLPTPPIY  660
IFIPYQMQTL QTVQPLLRKG HRSSKANPIP ISIPSKSQTT IPIPFIHPLI YVTTSTLLRH  720
VPAPPRPMSI TIILITQLEA AGQKSLNIIR PSPLGPNIYP SYPDSWIVDT NLVGLGNVVR  780
NDHGSLIYGA SHCCCASSAI GVEAQAAIVA LSFAKNYFHF PTQIEPTAKN *
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna16150.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.26e-37GATA transcription factor 11