PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | mrna14942.1-v1.0-hybrid | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 158aa MW: 17845 Da PI: 4.6758 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 41.7 | 2.4e-13 | 31 | 91 | 3 | 63 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 +l++ +r+ +NRe+ArrsR RK++ + L+ v L +eN + ++ ++++ +l++e+ mrna14942.1-v1.0-hybrid 31 DLRKRKRMVSNRESARRSRMRKQEHLTDLTAQVGLLRKENNQILTSINVTNQLYLNLEAEN 91 58999*******************************************9999999999876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.3E-13 | 29 | 93 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 9.933 | 31 | 78 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 3.62E-12 | 32 | 87 | No hit | No description |
Pfam | PF00170 | 2.7E-10 | 32 | 90 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14702 | 2.03E-17 | 34 | 84 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 1.2E-9 | 34 | 108 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 36 | 51 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0009005 | anatomy | root | ||||
PO:0007134 | developmental stage | sporophyte vegetative stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 158 aa Download sequence Send to blast |
MATSSGNSSG SSALQIMNSG SDQEGLHQVM DLRKRKRMVS NRESARRSRM RKQEHLTDLT 60 AQVGLLRKEN NQILTSINVT NQLYLNLEAE NCVLRAQVAE LTNRLQSLND IVDCIDSTKW 120 LLDNEEEEDM TAQFGGDEFL NPWSNLCFNQ PVDMFMC* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 45 | 52 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the DNA G-box motif 5'-CACGTG-3' of MAN7 promoter. Involved in the positive regulation of seed germination through MAN7 gene activation. MAN7 is required for both, loosening of the micropylar endosperm, and rupture of the seed coat in germinating seeds. {ECO:0000269|PubMed:23461773}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | mrna14942.1-v1.0-hybrid |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004287866.1 | 1e-113 | PREDICTED: ocs element-binding factor 1-like | ||||
Swissprot | C0Z2L5 | 1e-40 | BZP44_ARATH; bZIP transcription factor 44 | ||||
TrEMBL | A0A2P6RM56 | 5e-93 | A0A2P6RM56_ROSCH; Putative transcription factor bZIP family | ||||
STRING | XP_004287866.1 | 1e-112 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF613 | 34 | 147 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G75390.1 | 2e-40 | basic leucine-zipper 44 |
Link Out ? help Back to Top | |
---|---|
Phytozome | mrna14942.1-v1.0-hybrid |
Publications ? help Back to Top | |||
---|---|---|---|
|