PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna12069.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family ZF-HD
Protein Properties Length: 255aa    MW: 27283.3 Da    PI: 7.6649
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna12069.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer1031.9e-3252106358
              ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                              ++rY+eClkNhA+++Ggha+DGCgEf+++ geeg+ +alkCaAC+CHRnFHR+e++
  mrna12069.1-v1.0-hybrid  52 TIRYRECLKNHAVNIGGHALDGCGEFLAA-GEEGSLDALKCAACNCHRNFHRKEPA 106
                              689*************************9.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-2320104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.8E-2953105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.9E-2954104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.41855104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466893.01E-20178252IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-31190253IPR009057Homeodomain-like
TIGRFAMsTIGR015656.2E-27191247IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MEFNDHHEDQ DEDMELSPTA PTPPGYDSSR SKMGPTSGGG GGDGAARKRV PTIRYRECLK  60
NHAVNIGGHA LDGCGEFLAA GEEGSLDALK CAACNCHRNF HRKEPAEGGG GGATIAHQQH  120
SQQQPFSAYY GHPYPPPPPS GYLHLTPAQP QRPLALPAAA GSGGSHSREE LDDVSNPSSS  180
GGGGSGVGLL RKRFRTKFTA EQKEKMVEFA EKVGWRIQKH DEAAVEEFCA VTGVKRQVLK  240
VWMHNNKHTI GKKP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A5e-291922491875ZF-HD homeobox family protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtEssential protein. Putative transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna12069.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004299701.10.0PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotQ9SB613e-78ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBLA0A059BKP66e-98A0A059BKP6_EUCGR; Uncharacterized protein
STRINGXP_004299701.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.14e-68homeobox protein 22
Publications ? help Back to Top
  1. Bueso E,Serrano R,Pallás V,Sánchez-Navarro JA
    Seed tolerance to deterioration in arabidopsis is affected by virus infection.
    Plant Physiol. Biochem., 2017. 116: p. 1-8
    [PMID:28477474]