PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | mrna09407.1-v1.0-hybrid | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 189aa MW: 21409.5 Da PI: 9.0194 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53.6 | 5e-17 | 13 | 60 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W+ +Ed++l+d+++++G g+W++ ++ g++R++k+c++rw +yl mrna09407.1-v1.0-hybrid 13 KGAWSIQEDQKLIDYIQKHGEGCWNSLPKAAGLRRCGKSCRLRWINYL 60 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 56 | 9.1e-18 | 66 | 111 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+++++E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l mrna09407.1-v1.0-hybrid 66 RGSFSEDEEDLIIRLHKLLGNR-WSLIAGRLP-GRTDNEVKNYWNSHL 111 899*******************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 6.2E-24 | 4 | 63 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 15.033 | 8 | 60 | IPR017930 | Myb domain |
SMART | SM00717 | 1.1E-11 | 12 | 62 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.27E-29 | 12 | 107 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.1E-15 | 13 | 60 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.43E-9 | 15 | 60 | No hit | No description |
PROSITE profile | PS51294 | 27.564 | 61 | 115 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.2E-26 | 64 | 115 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.0E-17 | 65 | 113 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-16 | 66 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.47E-12 | 68 | 111 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 189 aa Download sequence Send to blast |
MRKPCCEKTE TTKGAWSIQE DQKLIDYIQK HGEGCWNSLP KAAGLRRCGK SCRLRWINYL 60 RPDLKRGSFS EDEEDLIIRL HKLLGNRWSL IAGRLPGRTD NEVKNYWNSH LKKKILNTGT 120 TLRPNKPRPE IKHAPYNKLV KYFNEMDDEV VDEVSSADSA AGCLVPELNL DLTLSIKTST 180 GMADPQVA* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-30 | 10 | 115 | 24 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269|PubMed:11080161}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | mrna09407.1-v1.0-hybrid |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By ethylene, asbscisic acid (ABA), auxin (IAA), and Pseudomonas syringae pv. phaseolica. {ECO:0000269|PubMed:9839469}. | |||||
UniProt | INDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18541146, ECO:0000269|PubMed:9839469}. | |||||
UniProt | INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269|PubMed:11080161}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF401220 | 0.0 | AF401220.1 Fragaria x ananassa transcription factor MYB1 (MYB1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004299542.1 | 1e-139 | PREDICTED: transcription factor MYB3-like | ||||
Swissprot | Q38851 | 2e-66 | MYB6_ARATH; Transcription repressor MYB6 | ||||
Swissprot | Q9S9K9 | 4e-66 | MYB3_ARATH; Transcription factor MYB3 | ||||
Swissprot | Q9SZP1 | 7e-66 | MYB4_ARATH; Transcription repressor MYB4 | ||||
TrEMBL | E7BLK1 | 1e-127 | E7BLK1_9ROSA; Transcription factor | ||||
TrEMBL | Q94EN3 | 1e-127 | Q94EN3_FRAAN; R2R3-MYB transcription factor MYB1-1 | ||||
STRING | XP_004299542.1 | 1e-138 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF264 | 34 | 221 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09460.1 | 4e-68 | myb domain protein 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | mrna09407.1-v1.0-hybrid |