PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | FANhyb_rscf00004706.1.g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | WOX | ||||||||
Protein Properties | Length: 117aa MW: 13432.1 Da PI: 8.9842 | ||||||||
Description | WOX family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 64.2 | 1.9e-20 | 22 | 82 | 2 | 57 |
T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 +R+++tkeq+++Le+l+ek r+psae ++ +++l +++ ++V++WFqN++a++++ FANhyb_rscf00004706.1.g00001.1 22 TTRWNPTKEQITILEDLYEKgMRTPSAEFIQAVTARLntygHIEGKNVFYWFQNHKARQRQ 82 58*****************99**************************************97 PP | |||||||
2 | Wus_type_Homeobox | 114.6 | 4.9e-37 | 21 | 83 | 2 | 64 |
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 ++tRW+Pt+eQi+iLe+ly++G+rtP++e iq +ta+L++yG+ie+kNVfyWFQN+kaR+rqk FANhyb_rscf00004706.1.g00001.1 21 NTTRWNPTKEQITILEDLYEKGMRTPSAEFIQAVTARLNTYGHIEGKNVFYWFQNHKARQRQK 83 689***********************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50071 | 10.236 | 18 | 83 | IPR001356 | Homeobox domain |
SMART | SM00389 | 2.2E-4 | 20 | 87 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 4.5E-8 | 23 | 82 | IPR009057 | Homeodomain-like |
Pfam | PF00046 | 4.7E-18 | 23 | 82 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 5.13E-13 | 23 | 89 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 1.03E-4 | 23 | 84 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0008284 | Biological Process | positive regulation of cell proliferation | ||||
GO:0009942 | Biological Process | longitudinal axis specification | ||||
GO:0010654 | Biological Process | apical cell fate commitment | ||||
GO:0048825 | Biological Process | cotyledon development | ||||
GO:0080167 | Biological Process | response to karrikin | ||||
GO:0090451 | Biological Process | cotyledon boundary formation | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
MEGEDQQVKK GGLALGVGLE NTTRWNPTKE QITILEDLYE KGMRTPSAEF IQAVTARLNT 60 YGHIEGKNVF YWFQNHKARQ RQKEKQESSL AYSNRFLHTA VASQYPLFPP PPQYPCS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in embryonic patterning. Required for apical embryo development after fertilization. Its specific localization to the apical daughter cell of the zygote, while WOX8 is confined to the basal cell, suggests that the asymmetric division of the plant zygote separates determinants of apical and basal cell fates. {ECO:0000269|PubMed:14711878}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004295925.1 | 7e-65 | PREDICTED: WUSCHEL-related homeobox 2 | ||||
Swissprot | Q6X7K1 | 1e-37 | WOX2_ARATH; WUSCHEL-related homeobox 2 | ||||
TrEMBL | A0A2P6QII2 | 6e-57 | A0A2P6QII2_ROSCH; Putative transcription factor Homobox-WOX family | ||||
STRING | XP_004295925.1 | 3e-64 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF8256 | 30 | 44 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G59340.1 | 2e-38 | WUSCHEL related homeobox 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|