PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G59340.1

Common Name

MNC17.25, WOX2

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

WOX

Protein Properties

Length: 260aa MW: 29183.4 Da PI: 9.3081

Description

WUSCHEL related homeobox 2

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G59340.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	63.2	3.9e-20	13	72	3	57
--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 +R+++tk+q++ Le+l+++ r+psa+++++++ +l +++ ++V++WFqN++a++++ AT5G59340.1 13 SRWNPTKDQITLLENLYKEgIRTPSADQIQQITGRLraygHIEGKNVFYWFQNHKARQRQ 72 8***************99************************************97 PP
2	Wus_type_Homeobox	115.2	3.2e-37	11	74	2	65
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 +++RW+Pt++Qi++Le+lyk+G+rtP++++iq+it +L++yG+ie+kNVfyWFQN+kaR+rqkq AT5G59340.1 11 SSSRWNPTKDQITLLENLYKEGIRTPSADQIQQITGRLRAYGHIEGKNVFYWFQNHKARQRQKQ 74 689***********************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	5.13E-12	7	79	IPR009057	Homeodomain-like
PROSITE profile	PS50071	10.787	8	73	IPR001356	Homeobox domain
SMART	SM00389	4.7E-5	10	77	IPR001356	Homeobox domain
Pfam	PF00046	7.9E-18	13	72	IPR001356	Homeobox domain
Gene3D	G3DSA:1.10.10.60	1.5E-7	13	72	IPR009057	Homeodomain-like
CDD	cd00086	8.85E-6	14	74	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0008284	Biological Process	positive regulation of cell proliferation
GO:0009942	Biological Process	longitudinal axis specification
GO:0010654	Biological Process	apical cell fate commitment
GO:0048825	Biological Process	cotyledon development
GO:0080167	Biological Process	response to karrikin
GO:0090451	Biological Process	cotyledon boundary formation
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000037	anatomy	shoot apex
PO:0000423	anatomy	plant zygote
PO:0008019	anatomy	leaf lamina base
PO:0009006	anatomy	shoot system
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020094	anatomy	plant egg cell
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025284	anatomy	embryo apical cell
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 260 aa Download sequence Send to blast
MENEVNAGTA SSSRWNPTKD QITLLENLYK EGIRTPSADQ IQQITGRLRA YGHIEGKNVF 60 YWFQNHKARQ RQKQKQERMA YFNRLLHKTS RFFYPPPCSN VGCVSPYYLQ QASDHHMNQH 120 GSVYTNDLLH RNNVMIPSGG YEKRTVTQHQ KQLSDIRTTA ATRMPISPSS LRFDRFALRD 180 NCYAGEDINV NSSGRKTLPL FPLQPLNASN ADGMGSSSFA LGSDSPVDCS SDGAGREQPF 240 IDFFSGGSTS TRFDSNGNGL

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	247714_at	0.0
Expression Atlas	AT5G59340	-
AtGenExpress	AT5G59340	-
ATTED-II	AT5G59340	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Detected in the egg cell and the central cell of the embryo sac, but not in the synergids, the antipodals or the male gametophyte. After fertilization, it is expressed in the zygote. After the first division of the zygote, it is detected exclusively in the apical daughter cell, while WOX8 is expressed in the basal daughter cell. Subsequently, it is expressed in all cells of the 4-cell embryo proper and predominantly in the apical domain of the 8-cell embryo. However, in some 8-cell embryos it is also weakly expressed in the central domain suggesting that expression shifts to the most apical cells during this stage. Expression remains restricted to the apical domain in the 16-cell embryo and the early-globular stage. Not expressed in the apical domain thereafter. However, in heart stage embryos it is weakly expressed in a ring of epidermal cells approximately at the junction of hypocotyl and root. Not expressed in mature embryos, endosperm or postembryonically in inflorescences. {ECO:0000269\|PubMed:14711878}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a WUSCHEL-related homeobox gene family member with 65 amino acids in its homeodomain. Proteins in this family contain a sequence of eight residues (TLPLFPMH) downstream of the homeodomain called the WUS box. WOX2 has a putative Zinc finger domain downstream of the homeodomain. Transcripts are expressed in the egg cell, the zygote and the apical cell lineage and are reduced in met3-1 early embryos. This gene is necessary for cell divisions that form the apical embryo domain.
UniProt	Probable transcription factor involved in embryonic patterning. Required for apical embryo development after fertilization. Its specific localization to the apical daughter cell of the zygote, while WOX8 is confined to the basal cell, suggests that the asymmetric division of the plant zygote separates determinants of apical and basal cell fates. {ECO:0000269\|PubMed:14711878}.

Function -- GeneRIF ? help Back to Top
combinatorial action of WOX transcription factors is essential for Arabidopsis embryonic development. [PMID: 17706632] Differential expression of WOX2 gene mediates apical-basal axis formation in the Arabidopsis embryo. [PMID: 18539115] Loss of WOX2 and WOX8 lead to the development of partially fused cotyledons. [PMID: 22827849]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G59340.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT5G45980 (A)

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G59340

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY251393	0.0	AY251393.1 Arabidopsis thaliana clone 2 WOX2 protein mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_200742.2	0.0	WUSCHEL related homeobox 2
Swissprot	Q6X7K1	0.0	WOX2_ARATH; WUSCHEL-related homeobox 2
TrEMBL	C0SVU6	0.0	C0SVU6_ARATH; Uncharacterized protein At5g59340 (Fragment)
STRING	AT5G59340.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM6914	28	44
Representative plant	OGRP8582	11	16

Link Out ? help Back to Top
Phytozome	AT5G59340.1
Entrez Gene	836053
iHOP	AT5G59340
wikigenes	AT5G59340

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Wang D,Harper JF,Gribskov M Systematic trans-genomic comparison of protein kinases between Arabidopsis and Saccharomyces cerevisiae. Plant Physiol., 2003. 132(4): p. 2152-65 [PMID:12913170] Haecker A, et al. Expression dynamics of WOX genes mark cell fate decisions during early embryonic patterning in Arabidopsis thaliana. Development, 2004. 131(3): p. 657-68 [PMID:14711878] Sottosanto JB,Gelli A,Blumwald E DNA array analyses of Arabidopsis thaliana lacking a vacuolar Na+/H+ antiporter: impact of AtNHX1 on gene expression. Plant J., 2004. 40(5): p. 752-71 [PMID:15546358] Wu X,Chory J,Weigel D Combinations of WOX activities regulate tissue proliferation during Arabidopsis embryonic development. Dev. Biol., 2007. 309(2): p. 306-16 [PMID:17706632] Breuninger H,Rikirsch E,Hermann M,Ueda M,Laux T Differential expression of WOX genes mediates apical-basal axis formation in the Arabidopsis embryo. Dev. Cell, 2008. 14(6): p. 867-76 [PMID:18539115] Gebert M,Dresselhaus T,Sprunck S F-actin organization and pollen tube tip growth in Arabidopsis are dependent on the gametophyte-specific Armadillo repeat protein ARO1. Plant Cell, 2008. 20(10): p. 2798-814 [PMID:18931021] Palovaara J,Hakman I WOX2 and polar auxin transport during spruce embryo pattern formation. Plant Signal Behav, 2009. 4(2): p. 153-5 [PMID:19649198] Nelson DC, et al. Karrikins enhance light responses during germination and seedling development in Arabidopsis thaliana. Proc. Natl. Acad. Sci. U.S.A., 2010. 107(15): p. 7095-100 [PMID:20351290] Hirakawa Y,Kondo Y,Fukuda H TDIF peptide signaling regulates vascular stem cell proliferation via the WOX4 homeobox gene in Arabidopsis. Plant Cell, 2010. 22(8): p. 2618-29 [PMID:20729381] Zhang X,Zong J,Liu J,Yin J,Zhang D Genome-wide analysis of WOX gene family in rice, sorghum, maize, Arabidopsis and poplar. J Integr Plant Biol, 2010. 52(11): p. 1016-26 [PMID:20977659] Ueda M,Zhang Z,Laux T Transcriptional activation of Arabidopsis axis patterning genes WOX8/9 links zygote polarity to embryo development. Dev. Cell, 2011. 20(2): p. 264-70 [PMID:21316593] Causier B,Ashworth M,Guo W,Davies B The TOPLESS interactome: a framework for gene repression in Arabidopsis. Plant Physiol., 2012. 158(1): p. 423-38 [PMID:22065421] Lie C,Kelsom C,Wu X WOX2 and STIMPY-LIKE/WOX8 promote cotyledon boundary formation in Arabidopsis. Plant J., 2012. 72(4): p. 674-82 [PMID:22827849] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Liang Z,Brown RC,Fletcher JC,Opsahl-Sorteberg HG Calpain-Mediated Positional Information Directs Cell Wall Orientation to Sustain Plant Stem Cell Activity, Growth and Development. Plant Cell Physiol., 2015. 56(9): p. 1855-66 [PMID:26220906] Zhu T,Moschou PN,Alvarez JM,Sohlberg JJ,von Arnold S WUSCHEL-RELATED HOMEOBOX 2 is important for protoderm and suspensor development in the gymnosperm Norway spruce. BMC Plant Biol., 2016. 16: p. 19 [PMID:26786587] Zhang Z,Tucker E,Hermann M,Laux T A Molecular Framework for the Embryonic Initiation of Shoot Meristem Stem Cells. Dev. Cell, 2017. 40(3): p. 264-277.e4 [PMID:28171749]