PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | FANhyb_rscf00000586.1.g00002.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 228aa MW: 26050.2 Da PI: 9.0366 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 64 | 2.9e-20 | 32 | 79 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+++++ +G + Wk+Ia++ g++R++k+c++rw++yl FANhyb_rscf00000586.1.g00002.1 32 KGAWTAEEDQKLAEVIAIHGAKKWKSIAAKAGLNRCGKSCRLRWLNYL 79 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 50.5 | 4.9e-16 | 85 | 130 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l FANhyb_rscf00000586.1.g00002.1 85 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 130 78999*****************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 26.986 | 27 | 83 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.14E-29 | 30 | 126 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.4E-16 | 31 | 81 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.4E-19 | 32 | 79 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.1E-25 | 33 | 86 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 9.86E-12 | 34 | 79 | No hit | No description |
PROSITE profile | PS51294 | 20.436 | 84 | 134 | IPR017930 | Myb domain |
SMART | SM00717 | 1.9E-15 | 84 | 132 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.0E-14 | 85 | 130 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.4E-24 | 87 | 134 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.10E-10 | 89 | 130 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009957 | Biological Process | epidermal cell fate specification | ||||
GO:0032880 | Biological Process | regulation of protein localization | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0048629 | Biological Process | trichome patterning | ||||
GO:2000039 | Biological Process | regulation of trichome morphogenesis | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 228 aa Download sequence Send to blast |
MAPKREESAK REVMKMKSLE AVMKNTKREV NKGAWTAEED QKLAEVIAIH GAKKWKSIAA 60 KAGLNRCGKS CRLRWLNYLR PNIKRGNISD QEEDLILRLH KLLGNRWSLI AGRLPGRTDN 120 EIKNYWNSHL SKRISQIEKQ KSTGEADDST RQIPTVDQKP SSRLGEQNKI FGEMKQDSSS 180 EEGTTTSASN KGGDDHEDYS NSDIDIDDFF DFSNEGPFNL EWVNKFLY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-29 | 32 | 134 | 7 | 108 | B-MYB |
1h8a_C | 3e-29 | 29 | 134 | 24 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in leaves. Together with TTG1 and GL3, promotes trichome formation and endoreplication. Regulates the production of a signal that induces hair (trichome) precursor cells on leaf primordia to differentiate. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes (By similarity). {ECO:0000250, ECO:0000269|PubMed:11063707, ECO:0000269|PubMed:12356720, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15728674, ECO:0000269|PubMed:9625690}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by gibberellins (PubMed:9625690). May be regulated by GEBP and GEBP-like proteins (PubMed:12535344). {ECO:0000269|PubMed:12535344, ECO:0000269|PubMed:9625690}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004305745.1 | 1e-168 | PREDICTED: transcription factor WER-like | ||||
Swissprot | P27900 | 1e-53 | GL1_ARATH; Trichome differentiation protein GL1 | ||||
TrEMBL | A0A2P6RYJ2 | 1e-139 | A0A2P6RYJ2_ROSCH; Putative transcription factor MYB-HB-like family | ||||
STRING | XP_004305745.1 | 1e-168 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2148 | 32 | 88 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27920.1 | 9e-56 | myb domain protein 0 |