PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | FANhyb_rscf00000554.1.g00007.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 156aa MW: 16994.6 Da PI: 8.3633 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 136.2 | 1.2e-42 | 8 | 106 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgv 79 +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvh+++Gasnv k+l++l+ +reda++sl+yeAear+rdPvyG+vg+ FANhyb_rscf00000554.1.g00007.1 8 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHRVYGASNVAKILNELNAAHREDAVTSLAYEAEARLRDPVYGCVGL 86 7****************************************************************************** PP DUF260 80 ilklqqqleqlkaelallke 99 i+ lq +l++l+++l +k+ FANhyb_rscf00000554.1.g00007.1 87 ISILQDRLKKLQTDLYNAKK 106 **************988876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 25.765 | 7 | 108 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.3E-42 | 8 | 105 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009954 | Biological Process | proximal/distal pattern formation | ||||
GO:0009965 | Biological Process | leaf morphogenesis | ||||
GO:0048441 | Biological Process | petal development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 156 aa Download sequence Send to blast |
MSSNTHSPCA ACKFLRRKCT QECVFAPYFP PDQPQKFANV HRVYGASNVA KILNELNAAH 60 REDAVTSLAY EAEARLRDPV YGCVGLISIL QDRLKKLQTD LYNAKKDLST YIGPQALMIP 120 VFHPSPQPEM NGGGAMAVPM LGVPTGPQQV PSGYGC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-48 | 7 | 124 | 10 | 127 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-48 | 7 | 124 | 10 | 127 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011460237.1 | 1e-106 | PREDICTED: LOB domain-containing protein 36-like | ||||
Refseq | XP_011460238.1 | 1e-106 | PREDICTED: LOB domain-containing protein 36-like | ||||
Refseq | XP_011460239.1 | 1e-106 | PREDICTED: LOB domain-containing protein 36-like | ||||
Refseq | XP_011460240.1 | 1e-106 | PREDICTED: LOB domain-containing protein 36-like | ||||
Refseq | XP_011460241.1 | 1e-106 | PREDICTED: LOB domain-containing protein 36-like | ||||
Swissprot | Q9FKZ3 | 1e-66 | LBD36_ARATH; LOB domain-containing protein 36 | ||||
TrEMBL | A0A2P6Q5T3 | 1e-101 | A0A2P6Q5T3_ROSCH; Putative transcription factor AS2-LOB family | ||||
STRING | XP_008371805.1 | 9e-90 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2353 | 34 | 84 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G66870.1 | 6e-69 | ASYMMETRIC LEAVES 2-like 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|