PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | FANhyb_icon20555326_s.1.g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | SAP | ||||||||
Protein Properties | Length: 130aa MW: 14058.9 Da PI: 5.1367 | ||||||||
Description | SAP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SAP | 157.5 | 1e-48 | 1 | 126 | 329 | 454 |
SAP 329 lrnqgvvlreeeerrGlivssldasneayvvvdsrGvatvrrvenleevcrfrvrg.aqrgvlgCvnggyalvyagg 404 lrnqgvvl+++e rrG++v+s+d+sn yvvv +rG+a+vrr+++ +e+crf v g q gv+gC+nggyal+++gg FANhyb_icon20555326_s.1.g00001.1 1 LRNQGVVLADDEYRRGVVVTSVDVSNGRYVVVGNRGMARVRRADTAQEMCRFMVLGaGQMGVMGCMNGGYALMCGGG 77 8*****************************************************9989******************* PP SAP 405 vlrvWeiekkegylyslrervgevnalvaddrhvavsssdgtihlldfga 454 +rvWe+e+ e yly+++e vg v a+v d+rhva+ sd+t+hl+dfga FANhyb_icon20555326_s.1.g00001.1 78 AVRVWEVERGE-YLYNFTEPVGAVSAFVCDERHVAAWGSDTTLHLWDFGA 126 *********77.*************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF50998 | 1.02E-11 | 16 | 127 | IPR011047 | Quinoprotein alcohol dehydrogenase-like superfamily |
Gene3D | G3DSA:2.130.10.10 | 2.8E-9 | 19 | 124 | IPR015943 | WD40/YVTN repeat-like-containing domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009554 | Biological Process | megasporogenesis | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0030163 | Biological Process | protein catabolic process | ||||
GO:0046622 | Biological Process | positive regulation of organ growth | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005515 | Molecular Function | protein binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 130 aa Download sequence Send to blast |
LRNQGVVLAD DEYRRGVVVT SVDVSNGRYV VVGNRGMARV RRADTAQEMC RFMVLGAGQM 60 GVMGCMNGGY ALMCGGGAVR VWEVERGEYL YNFTEPVGAV SAFVCDERHV AAWGSDTTLH 120 LWDFGAGAAE |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator involved in the specification of floral identity. Acts as A class cadastral protein by repressing the C class floral homeotic gene AGAMOUS in the external flower organs in association with APETALA2 and other repressors. Is required to maintain floral meristem identity in concert with AGAMOUS. Interacts also with APETALA2 to ensure the normal development of ovule. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004305672.1 | 1e-86 | PREDICTED: transcriptional regulator STERILE APETALA | ||||
Swissprot | Q9FKH1 | 1e-38 | SAP_ARATH; Transcriptional regulator STERILE APETALA | ||||
TrEMBL | A0A2P6S1F3 | 2e-60 | A0A2P6S1F3_ROSCH; Putative transcription factor WD40-like family | ||||
STRING | XP_004305672.1 | 4e-86 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF7687 | 31 | 46 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G35770.1 | 6e-41 | SAP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|