PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462939086 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 202aa MW: 23144 Da PI: 8.1987 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.7 | 2e-16 | 18 | 65 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W+++Ede+l+ ++ +G gtW+++a+ g+++++k+c++rw +yl 462939086 18 KGLWSPDEDERLYSHIRNYGVGTWSSVAELAGLKKSGKSCRLRWMNYL 65 678*****************************99************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 21.647 | 13 | 69 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 9.94E-23 | 16 | 106 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.0E-12 | 17 | 67 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.8E-15 | 18 | 65 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.5E-19 | 19 | 72 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.91E-10 | 21 | 65 | No hit | No description |
PROSITE profile | PS51294 | 8.812 | 70 | 114 | IPR017930 | Myb domain |
SMART | SM00717 | 0.013 | 70 | 112 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.3E-12 | 73 | 114 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 202 aa Download sequence Send to blast |
MASEEKEGAK PCVTKKRKGL WSPDEDERLY SHIRNYGVGT WSSVAELAGL KKSGKSCRLR 60 WMNYLRPDLR MEPISKQEED LIISLQKVLG NTRMPGRTDN EIKNYWNSRI KKKLRRTCAD 120 RYQSPETRQT AEKSAPFNTE DGNLDVTSSH NNSANEKPHS HFPIFACQLL TGEQNCEQAA 180 PYSSLSKNNE VDLLVEDYVD FL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-19 | 18 | 114 | 7 | 108 | B-MYB |
1h8a_C | 1e-19 | 18 | 114 | 27 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 108 | 114 | RIKKKLR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Possible transcription activator in response to an external signal. May be involved in the regulation of flavonoid biosynthesis. | |||||
UniProt | Transcription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation (PubMed:22708996). Regulates a specific set of target genes by binding DNA to the AC cis-element 5'-ACCTAC-3' (PubMed:23741471). Functions as a transcriptional regulator of stomatal closure. Plays a role the regulation of stomatal pore size independently of abscisic acid (ABA) (PubMed:16005292). Required for seed coat mucilage deposition during the development of the seed coat epidermis (PubMed:19401413). Involved in the induction of trichome initiation and branching by positively regulating GL1 and GL2. Required for gibberellin (GA) biosynthesis and degradation by positively affecting the expression of the enzymes that convert GA9 into the bioactive GA4, as well as the enzymes involved in the degradation of GA4 (PubMed:28207974). {ECO:0000269|PubMed:16005292, ECO:0000269|PubMed:19401413, ECO:0000269|PubMed:22708996, ECO:0000269|PubMed:23741471, ECO:0000269|PubMed:28207974}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462939086 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002448905.2 | 4e-68 | transcription factor MYB57 | ||||
Swissprot | P20027 | 8e-43 | MYB3_HORVU; Myb-related protein Hv33 | ||||
Swissprot | Q8VZQ2 | 2e-42 | MYB61_ARATH; Transcription factor MYB61 | ||||
TrEMBL | A0A1E5UMZ9 | 1e-68 | A0A1E5UMZ9_9POAL; Myb-related protein Hv33 | ||||
STRING | Sb05g001215.1 | 4e-61 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP8703 | 25 | 45 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09540.1 | 9e-45 | myb domain protein 61 |
Publications ? help Back to Top | |||
---|---|---|---|
|