PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462933509 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 218aa MW: 24074.1 Da PI: 8.6531 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.3 | 8.8e-19 | 41 | 88 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT +Ed llv++++++G g+W++ ar g++Rt+k+c++rw++yl 462933509 41 RGPWTVDEDVLLVNYIAKHGEGRWNSLARSAGLKRTGKSCRLRWLNYL 88 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 50 | 7e-16 | 94 | 137 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T+ E++l+++++ ++G++ W++Ia++++ gRt++++k++w++ 462933509 94 RGNITAAEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 137 7999******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 24.101 | 36 | 92 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.75E-31 | 38 | 135 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.9E-15 | 40 | 90 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.8E-17 | 41 | 88 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.0E-22 | 42 | 95 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 9.30E-13 | 43 | 88 | No hit | No description |
SMART | SM00717 | 3.2E-14 | 93 | 141 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 18.252 | 93 | 143 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.4E-14 | 94 | 137 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.7E-23 | 96 | 142 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.71E-11 | 98 | 137 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 218 aa Download sequence Send to blast |
MDMAAGGMGF DDLEEMLGTT VSPAGSAVSA AGSEDEADLR RGPWTVDEDV LLVNYIAKHG 60 EGRWNSLARS AGLKRTGKSC RLRWLNYLRP DVRRGNITAA EQLLILELHS RWGNRWSKIA 120 QHLPGRTDNE IKNYWRTRVQ KHAKQLRCDV NSRQFRDVVR CIWMPRLVER IQAEQQASSS 180 LAGAGDGDET TAAPMAATVS APAACQIASW VSAHTTTT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 1e-25 | 38 | 135 | 24 | 120 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269|PubMed:22301384}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462933509 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:22301384}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HF679434 | 1e-118 | HF679434.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB28 protein. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025806553.1 | 4e-99 | transcription factor MYB2-like | ||||
Swissprot | Q10MB4 | 5e-90 | MYB2_ORYSJ; Transcription factor MYB2 | ||||
TrEMBL | A0A3L6SV89 | 5e-98 | A0A3L6SV89_PANMI; Uncharacterized protein | ||||
STRING | Pavir.J03771.1.p | 2e-96 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP198 | 38 | 330 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G48000.1 | 8e-83 | myb domain protein 112 |
Publications ? help Back to Top | |||
---|---|---|---|
|