PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462931853
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family ARF
Protein Properties Length: 954aa    MW: 105239 Da    PI: 6.609
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462931853genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.74.4e-23127228199
                EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                f+k+lt sd++++g +++p++ ae++       ++++++  +l+ +d++  sW++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F   ++++ +l+
  462931853 127 FCKTLTASDTSTHGGFSVPRRAAEKIfppldftMQPPAQ--ELIAKDLHDISWKFRHIYRGQPKRHLLTTGWSVFVSTKRLLAGDSVLFI--RDEKSQLL 222
                99*****************************96555444..8************************************************..4567778* PP

                EEEE-S CS
         B3  94 vkvfrk 99 
                ++++r+
  462931853 223 LGIRRA 228
                **9997 PP

2Auxin_resp120.11.7e-39253335183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 aahaa+++s+F+++YnPras+seFv++++k++kal+++vs+GmRf+m feteds  rr++Gt++ + dldpvrW+nS+Wr+L+
   462931853 253 AAHAAANSSPFTIFYNPRASPSEFVIPLAKYNKALYTQVSLGMRFRMLFETEDSGVRRYMGTITCIGDLDPVRWKNSHWRNLQ 335
                 79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.35E-44117256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.6E-41119242IPR015300DNA-binding pseudobarrel domain
CDDcd100174.65E-20126227No hitNo description
PROSITE profilePS5086312.266127229IPR003340B3 DNA binding domain
PfamPF023624.0E-21127228IPR003340B3 DNA binding domain
SMARTSM010191.4E-23127229IPR003340B3 DNA binding domain
PfamPF065073.1E-34253335IPR010525Auxin response factor
PfamPF023095.3E-8827924IPR033389AUX/IAA domain
PROSITE profilePS5174525.665838931IPR000270PB1 domain
SuperFamilySSF542775.89E-9853917No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 954 aa     Download sequence    Send to blast
MKDHGSGGVT PSPGEGEKKA INSELWHACA GPLVSLPPVG SLVVYFPQGH SEQVAASMNK  60
ELDTIPSYPS LPSKLICKLL SLTLHADSET DEVYAQMTLQ PVNKYDRDAM LASELGLKQN  120
KQPTEFFCKT LTASDTSTHG GFSVPRRAAE KIFPPLDFTM QPPAQELIAK DLHDISWKFR  180
HIYRGQPKRH LLTTGWSVFV STKRLLAGDS VLFIRDEKSQ LLLGIRRASR PQPALSSSVL  240
SSDSMHIGIL AAAAHAAANS SPFTIFYNPR ASPSEFVIPL AKYNKALYTQ VSLGMRFRML  300
FETEDSGVRR YMGTITCIGD LDPVRWKNSH WRNLQVGWDE STASERRTRV SIWDIEPVAT  360
PFYICPPPFF RPKLPKQPGM PDDENEVESA FKRAMPWLAD DFALKDVQNA LFPGLSLVQW  420
MAMQQNPQML TGAAPAMQSQ YLTSNALGMQ DGTGSANEDP TKRLHIQAQN IGLPNSQAGS  480
KILQPSSSQL QQLGLPKSPT QRPGLPGLTT VGSLQQSQLT HTPQVQQTAD FQQALLQGQQ  540
PQLQQLSQSD LQLQLLQKIQ QQNLLSQLNP QHQSQLIQQL SQKSQEILQQ RVLQHQFGAA  600
DAMGQQLKHL QQTPLNHIAG SLTAQQLVRS HSALESGEPS SSTAPSGSRI SPINSLSRAH  660
QGSRNLPEMP STPQMDHLLQ EIQSKPDNRP KTDMQGSKET THVPNRHPAS DQLDASSATS  720
FCLDESPREG FSFPPVCLDS SVQVDPRDNF LISENVDTLM PDALLSRGMS SGKGICNLPS  780
AQRDHRDVEN ELSSAAFSSQ SFGVPDISFK PGSSSDVAVT DAGMPSQSLW NSQSQRMRTF  840
TKVQKRGSVG RSIDITRYRG YDDLRHDLAC MFGIQGQLED PYRTDWKLVY VDHENDILLV  900
GDDPWEEFVS CVKSIKILSS VEVQQMSLDG DLGCIPPQTQ ACSASDDANA WRSI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1651735647388Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Cis-element ? help Back to Top
SourceLink
PlantRegMap462931853
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin under dark condition. {ECO:0000269|PubMed:17408882}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7277410.0KJ727741.1 Zea mays clone pUT5682 ARF transcription factor (ARF27) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021305688.10.0auxin response factor 16 isoform X1
SwissprotA3B9A00.0ARFP_ORYSJ; Auxin response factor 16
TrEMBLA0A453R1770.0A0A453R177_AEGTS; Auxin response factor
STRINGSb10g006440.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90453338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19
Publications ? help Back to Top
  1. Shen C, et al.
    OsARF16, a transcription factor, is required for auxin and phosphate starvation response in rice (Oryza sativa L.).
    Plant Cell Environ., 2013. 36(3): p. 607-20
    [PMID:22913536]
  2. Shen C, et al.
    OsARF16 is involved in cytokinin-mediated inhibition of phosphate transport and phosphate signaling in rice (Oryza sativa L.).
    PLoS ONE, 2014. 9(11): p. e112906
    [PMID:25386911]
  3. Shen C, et al.
    OsARF16, a transcription factor regulating auxin redistribution, is required for iron deficiency response in rice (Oryza sativa L.).
    Plant Sci., 2015. 231: p. 148-58
    [PMID:25576000]