PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

462918408

Organism

Eragrostis tef

Taxonomic ID

110835

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis

Family

MYB_related

Protein Properties

Length: 90aa MW: 10548.1 Da PI: 10.4679

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
462918408	genome	Tef	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	65.6	8.9e-21	16	63	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT++Ed+ll+++vkq+G g+W+++a+ g++R++k+c++rw +yl 462918408 16 KGPWTAQEDKLLLEYVKQHGEGRWNSVAKLTGLKRSGKSCRLRWVNYL 63 79********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	22.771	11	67	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	6.0E-24	13	66	IPR009057	Homeodomain-like
SMART	SM00717	2.2E-17	15	65	IPR001005	SANT/Myb domain
Pfam	PF00249	9.5E-20	16	63	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	9.23E-24	17	90	IPR009057	Homeodomain-like
CDD	cd00167	2.91E-12	18	63	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.9E-7	67	90	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 90 aa Download sequence Send to blast
MDGQFVWGRE EGGWRKGPWT AQEDKLLLEY VKQHGEGRWN SVAKLTGLKR SGKSCRLRWV 60 NYLRPDLKRG KITPQEESVI LELHSLWGNR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	1e-15	16	90	7	80	B-MYB
1h8a_C	2e-15	16	90	27	100	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269\|PubMed:22301384}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	462918408

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269\|PubMed:22301384}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK099283	5e-82	AK099283.1 Oryza sativa Japonica Group cDNA clone:J023132O17, full insert sequence.
GenBank	AK111807	5e-82	AK111807.1 Oryza sativa Japonica Group cDNA clone:J013104N22, full insert sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008645936.1	6e-56	myb-related protein 308
Swissprot	Q10MB4	2e-35	MYB2_ORYSJ; Transcription factor MYB2
TrEMBL	A0A1D6HD91	1e-54	A0A1D6HD91_MAIZE; R2R3MYB-domain protein
TrEMBL	A0A3L6EPW8	2e-55	A0A3L6EPW8_MAIZE; Transcription factor MYB62
STRING	Pavir.J37992.1.p	2e-56	(Panicum virgatum)
STRING	GRMZM2G027697_P01	2e-55	(Zea mays)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP198	38	330

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G24310.1	4e-45	myb domain protein 305

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Yang A,Dai X,Zhang WH A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice. J. Exp. Bot., 2012. 63(7): p. 2541-56 [PMID:22301384] Chen X, et al. The NAC family transcription factor OsNAP confers abiotic stress response through the ABA pathway. Plant Cell Physiol., 2014. 55(3): p. 604-19 [PMID:24399239] Lv Y, et al. New insights into the genetic basis of natural chilling and cold shock tolerance in rice by genome-wide association analysis. Plant Cell Environ., 2016. 39(3): p. 556-70 [PMID:26381647] Hong Y,Zhang H,Huang L,Li D,Song F Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice. Front Plant Sci, 2016. 7: p. 4 [PMID:26834774]