PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462918408 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 90aa MW: 10548.1 Da PI: 10.4679 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 65.6 | 8.9e-21 | 16 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT++Ed+ll+++vkq+G g+W+++a+ g++R++k+c++rw +yl 462918408 16 KGPWTAQEDKLLLEYVKQHGEGRWNSVAKLTGLKRSGKSCRLRWVNYL 63 79********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 22.771 | 11 | 67 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.0E-24 | 13 | 66 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.2E-17 | 15 | 65 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.5E-20 | 16 | 63 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 9.23E-24 | 17 | 90 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.91E-12 | 18 | 63 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.9E-7 | 67 | 90 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 90 aa Download sequence Send to blast |
MDGQFVWGRE EGGWRKGPWT AQEDKLLLEY VKQHGEGRWN SVAKLTGLKR SGKSCRLRWV 60 NYLRPDLKRG KITPQEESVI LELHSLWGNR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-15 | 16 | 90 | 7 | 80 | B-MYB |
1h8a_C | 2e-15 | 16 | 90 | 27 | 100 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269|PubMed:22301384}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462918408 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:22301384}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK099283 | 5e-82 | AK099283.1 Oryza sativa Japonica Group cDNA clone:J023132O17, full insert sequence. | |||
GenBank | AK111807 | 5e-82 | AK111807.1 Oryza sativa Japonica Group cDNA clone:J013104N22, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008645936.1 | 6e-56 | myb-related protein 308 | ||||
Swissprot | Q10MB4 | 2e-35 | MYB2_ORYSJ; Transcription factor MYB2 | ||||
TrEMBL | A0A1D6HD91 | 1e-54 | A0A1D6HD91_MAIZE; R2R3MYB-domain protein | ||||
TrEMBL | A0A3L6EPW8 | 2e-55 | A0A3L6EPW8_MAIZE; Transcription factor MYB62 | ||||
STRING | Pavir.J37992.1.p | 2e-56 | (Panicum virgatum) | ||||
STRING | GRMZM2G027697_P01 | 2e-55 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP198 | 38 | 330 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G24310.1 | 4e-45 | myb domain protein 305 |
Publications ? help Back to Top | |||
---|---|---|---|
|