PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

462916348

Organism

Eragrostis tef

Taxonomic ID

110835

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis

Family

bHLH

Protein Properties

Length: 92aa MW: 10431.7 Da PI: 7.3663

Description

bHLH family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
462916348	genome	Tef	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HLH	24	7.1e-08	20	59	15	54
HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 +i + ++L++llP+a +++ ++ a +L+++++YI+sL 462916348 20 QISDLVSKLQDLLPEARLQSNARVPSARVLQETCNYIRSL 59 789999*******889******************99 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.280.10	9.5E-9	3	78	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profile	PS50888	10.683	5	59	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamily	SSF47459	3.53E-9	18	79	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
Pfam	PF00010	4.9E-5	20	59	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 92 aa Download sequence Send to blast
MSNRRSRSRQ SGSSRITEEQ ISDLVSKLQD LLPEARLQSN ARVPSARVLQ ETCNYIRSLH 60 REVDDLSERL SELLATSDMS SAQEAIIRSL LM

Functional Description ? help Back to Top
Source	Description
UniProt	Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway (By similarity). {ECO:0000250}.
UniProt	Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway. {ECO:0000269\|PubMed:22363621}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	462916348

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	FP101485	6e-88	FP101485.1 Phyllostachys edulis cDNA clone: bphyst035e07, full insert sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004985540.2	2e-45	transcription factor ILI6
Refseq	XP_025792689.1	2e-45	transcription factor ILI6 isoform X2
Swissprot	B8APB5	2e-43	ILI6_ORYSI; Transcription factor ILI6
Swissprot	Q0DUR2	2e-43	ILI6_ORYSJ; Transcription factor ILI6
TrEMBL	A0A2T8I693	4e-44	A0A2T8I693_9POAL; Uncharacterized protein
TrEMBL	A0A368SV83	4e-44	A0A368SV83_SETIT; Uncharacterized protein
TrEMBL	A0A3L6S9J8	4e-44	A0A3L6S9J8_PANMI; Transcription factor ILI6
TrEMBL	K4AH74	4e-44	K4AH74_SETIT; Uncharacterized protein
STRING	Si038231m	7e-45	(Setaria italica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP2675	33	78

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G26945.1	3e-31	bHLH family protein