PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462909266 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 207aa MW: 23357.7 Da PI: 8.8013 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 182.7 | 9e-57 | 22 | 149 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100 lppGfrFhPtdee++++yL++k+ ++ ++ vi evd++k+ePwdLp+k+k +ekewyfF+++d+ky+tg+r+nrat+sgyWkatgkdke+++ +g lv 462909266 22 LPPGFRFHPTDEEIISHYLTPKALNRLFTS-GVIGEVDLNKCEPWDLPAKAKMGEKEWYFFCHKDRKYPTGTRTNRATESGYWKATGKDKEIFKGRGVLV 120 79************************9998.99***************99999*********************************************** PP NAM 101 glkktLvfykgrapkgektdWvmheyrle 129 g+kktLvfy+grap+gekt Wvmhe+rle 462909266 121 GMKKTLVFYRGRAPRGEKTGWVMHEFRLE 149 **************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.83E-64 | 15 | 172 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 59.261 | 22 | 172 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.0E-29 | 23 | 148 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005737 | Cellular Component | cytoplasm | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 207 aa Download sequence Send to blast |
MSEVSGINQA EVEDQAAGQL ELPPGFRFHP TDEEIISHYL TPKALNRLFT SGVIGEVDLN 60 KCEPWDLPAK AKMGEKEWYF FCHKDRKYPT GTRTNRATES GYWKATGKDK EIFKGRGVLV 120 GMKKTLVFYR GRAPRGEKTG WVMHEFRLEG RLPHPLPRSA KDEWAVCKVF NKELAARTAP 180 MAVAGAELER VGSLGFIADF LDNAELR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 9e-55 | 13 | 177 | 8 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 9e-55 | 13 | 177 | 8 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 9e-55 | 13 | 177 | 8 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 9e-55 | 13 | 177 | 8 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 9e-55 | 13 | 177 | 11 | 173 | NAC domain-containing protein 19 |
3swm_B | 9e-55 | 13 | 177 | 11 | 173 | NAC domain-containing protein 19 |
3swm_C | 9e-55 | 13 | 177 | 11 | 173 | NAC domain-containing protein 19 |
3swm_D | 9e-55 | 13 | 177 | 11 | 173 | NAC domain-containing protein 19 |
3swp_A | 9e-55 | 13 | 177 | 11 | 173 | NAC domain-containing protein 19 |
3swp_B | 9e-55 | 13 | 177 | 11 | 173 | NAC domain-containing protein 19 |
3swp_C | 9e-55 | 13 | 177 | 11 | 173 | NAC domain-containing protein 19 |
3swp_D | 9e-55 | 13 | 177 | 11 | 173 | NAC domain-containing protein 19 |
3ulx_A | 9e-55 | 13 | 173 | 6 | 169 | Stress-induced transcription factor NAC1 |
4dul_A | 9e-55 | 13 | 177 | 8 | 170 | NAC domain-containing protein 19 |
4dul_B | 9e-55 | 13 | 177 | 8 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00518 | DAP | Transfer from AT5G18270 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462909266 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU956395 | 0.0 | EU956395.1 Zea mays clone 1562064 GRAB2 protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002465330.1 | 1e-134 | NAC domain-containing protein 79 | ||||
Swissprot | Q9FK44 | 7e-89 | NAC87_ARATH; NAC domain-containing protein 87 | ||||
TrEMBL | C5X1Q2 | 1e-132 | C5X1Q2_SORBI; Uncharacterized protein | ||||
STRING | Sb01g036590.1 | 1e-133 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1862 | 38 | 104 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G18270.2 | 5e-92 | Arabidopsis NAC domain containing protein 87 |
Publications ? help Back to Top | |||
---|---|---|---|
|