PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462875262 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 209aa MW: 23605.2 Da PI: 9.5201 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 98.6 | 4.1e-31 | 138 | 196 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG+K+vk+s++pr+YYrC+s+gC+vkk+ver+++d+++v++tY g Hnh+ 462875262 138 LDDGYRWRKYGKKMVKNSPNPRNYYRCSSEGCHVKKRVERERDDERFVITTYDGVHNHP 196 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.9E-33 | 124 | 197 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 8.76E-28 | 131 | 197 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 31.559 | 133 | 198 | IPR003657 | WRKY domain |
SMART | SM00774 | 9.9E-36 | 138 | 197 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.1E-24 | 139 | 196 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 209 aa Download sequence Send to blast |
SSDRRRCRRR TRLSYPRARR IGSYLSFAAD VPEECYYHSP EAAVAAAFHS ERQGLLGALQ 60 EDDVDYSVMS GEAGSNGGRE ASEQSQTDAS TVLRPAGLAI RDTMINEGVS SGDDGRMSLP 120 TGRRGRIAFK TRSDVEVLDD GYRWRKYGKK MVKNSPNPRN YYRCSSEGCH VKKRVERERD 180 DERFVITTYD GVHNHPAVPL PHHRRPINS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 4e-25 | 122 | 195 | 1 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 4e-25 | 122 | 195 | 1 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462875262 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KR827403 | 4e-60 | KR827403.1 Triticum aestivum WRKY52 transcriptional factor mRNA, complete cds. | |||
GenBank | KT728909 | 4e-60 | KT728909.1 Triticum aestivum clone LKc001 WRKY protein mRNA, partial cds. | |||
GenBank | KT728910 | 4e-60 | KT728910.1 Triticum aestivum clone LKc002 WRKY protein mRNA, partial cds. | |||
GenBank | KT865877 | 4e-60 | KT865877.1 Triticum aestivum clone KL04 WRKY mRNA, partial cds. | |||
GenBank | KT865878 | 4e-60 | KT865878.1 Triticum aestivum clone KL05 WRKY mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004969405.1 | 2e-51 | probable WRKY transcription factor 50 | ||||
Swissprot | Q8VWQ5 | 2e-38 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | A0A3L6ST74 | 5e-50 | A0A3L6ST74_PANMI; Putative WRKY transcription factor 50 | ||||
STRING | Pavir.Eb02454.1.p | 5e-53 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP441 | 37 | 206 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 2e-31 | WRKY DNA-binding protein 50 |
Publications ? help Back to Top | |||
---|---|---|---|
|