PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

462863766

Organism

Eragrostis tef

Taxonomic ID

110835

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis

Family

NAC

Protein Properties

Length: 153aa MW: 17554.9 Da PI: 9.7257

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
462863766	genome	Tef	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	173	9.3e-54	11	139	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 +ppGfrFhPt+eel+++yL+kkv++++++l +vi++vd++k+ePwd+++ k+ + +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk++++ 462863766 11 VPPGFRFHPTEEELLNYYLRKKVASQQIDL-DVIRDVDLNKLEPWDIQEkcKIGSgPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIYN-AV 108 69**************************.9***********952444443456**********************************.88 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128 + +g++ktLvfykgrap+g+k+dW+mheyrl 462863766 109 KRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 139 99*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	3.4E-55	7	146	IPR003441	NAC domain
PROSITE profile	PS51005	52.455	11	153	IPR003441	NAC domain
Pfam	PF02365	3.2E-29	12	139	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 153 aa Download sequence Send to blast
MSISVNGQSC VPPGFRFHPT EEELLNYYLR KKVASQQIDL DVIRDVDLNK LEPWDIQEKC 60 KIGSGPQNDW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKAIYNAVKR IGMRKTLVFY 120 KGRAPHGQKS DWIMHEYRLD DPAADATTAT VNN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	2e-47	11	139	15	140	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269\|PubMed:16214898, ECO:0000269\|PubMed:17237351, ECO:0000269\|PubMed:17333250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	462863766

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KT075081	0.0	KT075081.1 Panicum virgatum secondary wall NAC master switch (SWN2A) mRNA, complete cds.
GenBank	KT075082	0.0	KT075082.1 Panicum virgatum secondary wall NAC master switch (SWN2B) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020164672.1	1e-103	NAC domain-containing protein 43-like
Refseq	XP_025820040.1	1e-103	NAC domain-containing protein 43-like
Swissprot	Q84WP6	6e-93	NAC43_ARATH; NAC domain-containing protein 43
TrEMBL	A0A453S1C6	1e-104	A0A453S1C6_AEGTS; Uncharacterized protein
STRING	Traes_7AL_B000BC0DD.2	1e-105	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1597	38	112

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G46770.1	7e-82	NAC family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Gondolf VM, et al. A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis. BMC Plant Biol., 2014. 14: p. 344 [PMID:25492673] Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons. GM Crops Food, 2014. 5(4): p. 302-20 [PMID:25523176] Yuan Y,Teng Q,Zhong R,Ye ZH TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan. Plant Cell Physiol., 2016. 57(1): p. 35-45 [PMID:26556650] Yang C, et al. Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation. Plant Physiol., 2017. 175(1): p. 333-350 [PMID:28724622] Pascual MB, et al. PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine. Plant Biotechnol. J., 2018. 16(5): p. 1094-1104 [PMID:29055073] Liu C,Yu H,Li L SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana. PLoS Genet., 2019. 15(1): p. e1007928 [PMID:30657769]