PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462856603 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 233aa MW: 25283.4 Da PI: 8.4829 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.1 | 4e-18 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd+ lv +v+++G+g+W++++ + g+ R+ k+c++rw +yl 462856603 15 KGPWTPEEDLVLVSYVQEHGPGNWRAVPGRAGLMRCSKSCRLRWTNYL 62 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 49.3 | 1.1e-15 | 68 | 113 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg ++++Ed l+v++ ++lG++ W++Ia++++ Rt++++k++w+++l 462856603 68 RGGFSEQEDRLIVHLQALLGNR-WAAIASYLP-DRTDNDVKNYWNTHL 113 7889******************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 24.039 | 10 | 66 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.59E-30 | 12 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.6E-13 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.8E-17 | 15 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.8E-23 | 16 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.74E-11 | 17 | 62 | No hit | No description |
SMART | SM00717 | 8.7E-16 | 67 | 115 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 19.14 | 67 | 117 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.1E-14 | 68 | 113 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.5E-23 | 70 | 116 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.34E-12 | 71 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 233 aa Download sequence Send to blast |
MGCPPCCDKG AGVKKGPWTP EEDLVLVSYV QEHGPGNWRA VPGRAGLMRC SKSCRLRWTN 60 YLRPGIRRGG FSEQEDRLIV HLQALLGNRW AAIASYLPDR TDNDVKNYWN THLKKKFLLL 120 NQQQQTQQQK CVSSSPSPPP PPNNNKGQWE SSFYALNATN VSMMLDGWAP RAAESGASRS 180 SSSTELTDCS AGSASTASNR VGGAPPLRLG VDADAMDGGV PPLSAIESWL DAN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 7e-28 | 15 | 117 | 27 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator involved in the activation of cuticular wax biosynthesis under drought stress. Binds directly to DNA consensus sequences found in the promoters of genes encoding very-long-chain fatty acid-condensing enzymes involved in cuticular wax biosynthesis (PubMed:21398568). Functions together with MYB94 in the activation of cuticular wax biosynthesis (PubMed:27577115). Involved in drought stress response through abscisic acid (ABA) signaling. Mediates ABA signals that enhance plant resistance to drought by reducing stomatal opening. Mediates ABA-auxin cross-talk to regulate lateral root growth under drought stress conditions (PubMed:19625633). Involved in the regulation of ABA biosynthesis and ABA-dependent seed dormancy state. Binds to the promoters of NCED2 and NCED6, which are enzymes catalyzing the first step of ABA biosynthesis (PubMed:25616734). Regulates seed germination by controlling the expression of ABI4, a repressor of lipid breakdown during seed germination (PubMed:25869652). Binds to the promoter of LTP3 and transactivates LTP3 gene in response to drought stress and freezing (PubMed:23404903). Involved in cold stress response. Binds directly to the promoters of heptahelical protein (HHP) genes in response to cold stress. HHPs modulate the expression of SCRM/ICE1, SCRM2/ICE2 and CAMTA3, which are upstream regulators of cold-responsive C-repeat-binding factors (CBFs) (PubMed:25912720). Involved in defense responses against the bacterial pathogen Pseudomonas syringae. May act as a molecular link that mediates cross-talks between ABA and salicylate (PubMed:20149112). Involved in a crosstalk between the circadian clock and ABA signaling. Binds directly to the promoter of APRR1/TOC1 to activate its expression (PubMed:26725725). {ECO:0000269|PubMed:19625633, ECO:0000269|PubMed:20149112, ECO:0000269|PubMed:21398568, ECO:0000269|PubMed:23404903, ECO:0000269|PubMed:25616734, ECO:0000269|PubMed:25869652, ECO:0000269|PubMed:25912720, ECO:0000269|PubMed:26725725, ECO:0000269|PubMed:27577115}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462856603 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA) (PubMed:19625633). Induced by infection with the cauliflower mosaic virus (CaMV) (PubMed:10226370). Induced by cold stress (PubMed:25912720). {ECO:0000269|PubMed:10226370, ECO:0000269|PubMed:19625633, ECO:0000269|PubMed:25912720}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU962848 | 1e-118 | EU962848.1 Zea mays clone 246006 myb transcription factor MYB30 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021318713.1 | 1e-87 | myb-related protein 306-like | ||||
Swissprot | Q24JK1 | 1e-73 | MYB96_ARATH; Transcription factor MYB96 | ||||
TrEMBL | A0A1B6QMW6 | 3e-86 | A0A1B6QMW6_SORBI; Uncharacterized protein | ||||
STRING | OPUNC03G18230.1 | 4e-86 | (Oryza punctata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP229 | 38 | 296 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28910.1 | 3e-69 | myb domain protein 30 |