PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462845378
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family NAC
Protein Properties Length: 300aa    MW: 33899.2 Da    PI: 9.4564
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462845378genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM144.46.4e-45121433128
        NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkya....tgkrknratksgyWkatgkdkevlsk.. 95 
                pGfrFhPt+eel+ +yLk+ v+gkkl++ ++i++v++y++ePw+Lp  +   +e+ewyfF++r  + +    +++r++r+t++g+Wkatg+d++v ++  
  462845378  12 PGFRFHPTEEELLEFYLKQVVQGKKLKF-DIIPRVQLYRHEPWELPgLARIVGEREWYFFVPRGDHRPpkqqQQQRPSRTTERGFWKATGSDRAVRCAad 110
                9**************************9.99***************533335789******987655443337889999*****************9877 PP

        NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                 ++l+glkktLv+y+grap+g+ktdWvm+eyrl
  462845378 111 PKRLIGLKKTLVYYEGRAPRGTKTDWVMNEYRL 143
                7788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100551.66310182IPR003441NAC domain
SuperFamilySSF1019417.45E-5111182IPR003441NAC domain
PfamPF023656.2E-2412143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MEGRGAAELE LPGFRFHPTE EELLEFYLKQ VVQGKKLKFD IIPRVQLYRH EPWELPGLAR  60
IVGEREWYFF VPRGDHRPPK QQQQQRPSRT TERGFWKATG SDRAVRCAAD PKRLIGLKKT  120
LVYYEGRAPR GTKTDWVMNE YRLPDKNNNN NNNNNASSSS SSSSSSSSPK DQDMVLCKIY  180
RKAVSLKELE QRVAMEELAR ATATPSSAST GDSSSSSSEH GGGDLQLGSR PCVMKKEETT  240
TSAATVMRPA TLSLPQLEVA RPPPSQQLLG AEWMQDPFLT QLRSPWMETW SPYYASVLNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-41718211168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462845378
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439057.11e-142NAC domain-containing protein 67
SwissprotQ10S653e-94NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLA0A194YLW21e-140A0A194YLW2_SORBI; Uncharacterized protein
STRINGSb10g030770.11e-141(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP177038105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.12e-70NAC domain containing protein 36
Publications ? help Back to Top
  1. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]