PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thhalv10028213m | ||||||||
Common Name | EUTSA_v10028213mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 184aa MW: 21308.1 Da PI: 9.4667 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 103.9 | 8.9e-33 | 101 | 159 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk++ +prsYYrCt+++C+vkk+v+r a+dp+vv++tYeg Hnh+ Thhalv10028213m 101 LDDGYRWRKYGQKSVKNNAHPRSYYRCTYHTCNVKKQVQRLAKDPNVVVTTYEGIHNHP 159 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 5.7E-33 | 88 | 159 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 8.11E-29 | 93 | 160 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.172 | 96 | 161 | IPR003657 | WRKY domain |
SMART | SM00774 | 3.3E-38 | 101 | 160 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.2E-26 | 102 | 159 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 184 aa Download sequence Send to blast |
MERQDINSML SLDVENSNTS YTTFSSFVDK TLMMMPPLTY SNEVLEPSSS PFSWYPTSLH 60 VHAPPPENDQ KGEKGKKKDK EKRSRKVPRI AFQTRSDDDV LDDGYRWRKY GQKSVKNNAH 120 PRSYYRCTYH TCNVKKQVQR LAKDPNVVVT TYEGIHNHPC EKLMETLNPL LRQLQFLSSF 180 SNL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-27 | 91 | 158 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 3e-27 | 91 | 158 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00539 | DAP | Transfer from AT5G41570 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Thhalv10028213m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF404864 | 1e-144 | AF404864.1 Arabidopsis thaliana WRKY transcription factor 24 (WRKY24) mRNA, complete cds. | |||
GenBank | AK227522 | 1e-144 | AK227522.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-13-N18. | |||
GenBank | BT004595 | 1e-144 | BT004595.1 Arabidopsis thaliana At5g41570 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006405331.1 | 1e-136 | probable WRKY transcription factor 24 | ||||
Swissprot | Q9FFS3 | 1e-105 | WRK24_ARATH; Probable WRKY transcription factor 24 | ||||
TrEMBL | V4LSI9 | 1e-135 | V4LSI9_EUTSA; Uncharacterized protein | ||||
STRING | XP_006405331.1 | 1e-136 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM509 | 28 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G41570.1 | 7e-79 | WRKY DNA-binding protein 24 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thhalv10028213m |
Entrez Gene | 18022928 |