PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thhalv10015835m | ||||||||
Common Name | EUTSA_v10015835mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 191aa MW: 21820.1 Da PI: 6.7253 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 43.9 | 5e-14 | 71 | 121 | 5 | 55 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 +++rr+ +NRe+ArrsR RK+ ++eL v+ L +eN++L ++l++ ++ Thhalv10015835m 71 RKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENHQLLDKLNQASDS 121 689***************************************999998776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 3.1E-10 | 67 | 138 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.519 | 69 | 117 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 4.6E-11 | 70 | 122 | No hit | No description |
Pfam | PF00170 | 3.8E-12 | 71 | 123 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 7.74E-13 | 71 | 120 | No hit | No description |
CDD | cd14702 | 3.17E-18 | 72 | 119 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 74 | 89 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 191 aa Download sequence Send to blast |
MQPINNSSSL SNMQQQDYFQ LNHYYNNLNP TTGVNLIHYP QIQELNLQSP ASNNSTTSDE 60 ATEEIFIINE RKQRRMVSNR ESARRSRMRK QRHLDELLSQ VAWLRSENHQ LLDKLNQASD 120 SNDLVLRENL ILKEENLELR QVITSMKKLR GAGGGSTNIH GRSCSSSLDH DLDQDLISSI 180 SDDPRTHHPS * |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 83 | 90 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00512 | DAP | Transfer from AT5G15830 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Thhalv10015835m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK352721 | 0.0 | AK352721.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-03-J15. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006400109.1 | 1e-137 | basic leucine zipper 43 | ||||
Swissprot | Q9FMC2 | 8e-32 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | E4MW24 | 1e-135 | E4MW24_EUTHA; mRNA, clone: RTFL01-03-J15 | ||||
TrEMBL | V4LGP3 | 1e-135 | V4LGP3_EUTSA; Uncharacterized protein | ||||
STRING | XP_006400109.1 | 1e-136 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM10632 | 15 | 32 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G15830.1 | 4e-63 | basic leucine-zipper 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thhalv10015835m |
Entrez Gene | 18018862 |
Publications ? help Back to Top | |||
---|---|---|---|
|