PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G15830.1

Common Name

AtbZIP3, bZIP3, F14F8_210

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

bZIP

Protein Properties

Length: 186aa MW: 21656.7 Da PI: 5.0497

Description

basic leucine-zipper 3

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G15830.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	46.5	7.7e-15	74	124	5	55
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 +++rr+ +NRe+ArrsR RK+ ++eL v+ L +eN++L ++l++ +++ AT5G15830.1 74 RKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENHQLLDKLNQVSDN 124 689*******************************************99876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	1.2E-13	70	134	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.818	72	135	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	1.2E-11	73	125	No hit	No description
Pfam	PF00170	1.0E-12	74	125	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	3.94E-13	74	124	No hit	No description
CDD	cd14702	5.27E-18	75	122	No hit	No description
PROSITE pattern	PS00036	0	77	92	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0009005	anatomy	root
PO:0009025	anatomy	vascular leaf
PO:0009046	anatomy	flower
PO:0020030	anatomy	cotyledon
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage

Sequence ? help Back to Top
Protein Sequence Length: 186 aa Download sequence Send to blast
MQPNYDSSSL NNMQQQDYFN LNNYYNNLNP STNNNNLNIL QYPQIQELNL QSPVSNNSTT 60 SDDATEEIFV INERKQRRMV SNRESARRSR MRKQRHLDEL LSQVAWLRSE NHQLLDKLNQ 120 VSDNNDLVIQ ENSSLKEENL ELRQVITSMK KLGGGIHDKY SSPSSMDELD QDFSSITDDP 180 RTHHPS

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	86	93	RRSRMRKQ

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.31747	0.0	root

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	26450721	0.0
Genevisible	246522_at	0.0
Expression Atlas	AT5G15830	-
AtGenExpress	AT5G15830	-
ATTED-II	AT5G15830	-

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269\|PubMed:26973252}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00512	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G15830.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G15830

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK117828	0.0	AK117828.1 Arabidopsis thaliana At5g15830 mRNA for putative bZIP transcription factor AtbZip3, complete cds, clone: RAFL18-02-O03.
GenBank	AL391144	0.0	AL391144.1 Arabidopsis thaliana DNA chromosome 5, BAC clone F14F8 (ESSA project).
GenBank	BT003683	0.0	BT003683.1 Arabidopsis thaliana At5g15830 mRNA, complete cds.
GenBank	CP002688	0.0	CP002688.1 Arabidopsis thaliana chromosome 5 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_197087.1	1e-132	basic leucine-zipper 3
Swissprot	Q9FMC2	4e-32	BZP43_ARATH; Basic leucine zipper 43
TrEMBL	A0A178UF06	1e-131	A0A178UF06_ARATH; BZIP3
TrEMBL	Q9LFU3	1e-131	Q9LFU3_ARATH; At5g15830
STRING	AT5G15830.1	1e-131	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM10632	15	32
Representative plant	OGRP3104	11	29

Link Out ? help Back to Top
Phytozome	AT5G15830.1
Entrez Gene	831440
iHOP	AT5G15830
wikigenes	AT5G15830

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Jakoby M, et al. bZIP transcription factors in Arabidopsis. Trends Plant Sci., 2002. 7(3): p. 106-11 [PMID:11906833] Satoh R,Fujita Y,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K A novel subgroup of bZIP proteins functions as transcriptional activators in hypoosmolarity-responsive expression of the ProDH gene in Arabidopsis. Plant Cell Physiol., 2004. 45(3): p. 309-17 [PMID:15047879] S ABA activates ADPR cyclase and cADPR induces a subset of ABA-responsive genes in Arabidopsis. Plant J., 2004. 38(3): p. 381-95 [PMID:15086800] Deppmann CD, et al. Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs. Nucleic Acids Res., 2004. 32(11): p. 3435-45 [PMID:15226410] Nagata T,Yamada H,Du Z,Todoriki S,Kikuchi S Microarray analysis of genes that respond to gamma-irradiation in Arabidopsis. J. Agric. Food Chem., 2005. 53(4): p. 1022-30 [PMID:15713015] Che P,Lall S,Nettleton D,Howell SH Gene expression programs during shoot, root, and callus development in Arabidopsis tissue culture. Plant Physiol., 2006. 141(2): p. 620-37 [PMID:16648215] Ehlert A, et al. Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors. Plant J., 2006. 46(5): p. 890-900 [PMID:16709202] Deppmann CD,Alvania RS,Taparowsky EJ Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks. Mol. Biol. Evol., 2006. 23(8): p. 1480-92 [PMID:16731568] Lee DJ, et al. Genome-wide expression profiling of ARABIDOPSIS RESPONSE REGULATOR 7(ARR7) overexpression in cytokinin response. Mol. Genet. Genomics, 2007. 277(2): p. 115-37 [PMID:17061125] Kuhn JM,Breton G,Schroeder JI mRNA metabolism of flowering-time regulators in wild-type Arabidopsis revealed by a nuclear cap binding protein mutant, abh1. Plant J., 2007. 50(6): p. 1049-62 [PMID:17488241] Matiolli CC, et al. The Arabidopsis bZIP gene AtbZIP63 is a sensitive integrator of transient abscisic acid and glucose signals. Plant Physiol., 2011. 157(2): p. 692-705 [PMID:21844310] Efroni I, et al. Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses. Dev. Cell, 2013. 24(4): p. 438-45 [PMID:23449474] Nowak K,Gaj MD Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis. J. Plant Physiol., 2016. 193: p. 119-26 [PMID:26973252] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470]