PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thhalv10015741m | ||||||||
Common Name | EUTSA_v10015741mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 173aa MW: 20183.9 Da PI: 9.4087 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 24.3 | 7.1e-08 | 97 | 136 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +T++E++l+ + ++ G + W++Ia +++ gR ++++ +w Thhalv10015741m 97 MTEQEEDLIFRMYRLVGDR-WDLIAGRVP-GRQPEEIERYWI 136 7****************99.*********.***********5 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 6.3E-6 | 93 | 141 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.50E-7 | 96 | 135 | No hit | No description |
Pfam | PF00249 | 3.6E-7 | 97 | 136 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 5.06E-7 | 98 | 136 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.5E-9 | 98 | 136 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 6.307 | 98 | 135 | IPR017877 | Myb-like domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010091 | Biological Process | trichome branching | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
CKGCSLDISL YLYLSLLLSS SSSSSSFSPY KISSLTFFFS CILQTKPQAS FYFPLSLLSI 60 TPILMNNTDR RRRRKQQKAT LHDSEEVSSI EWEFINMTEQ EEDLIFRMYR LVGDRWDLIA 120 GRVPGRQPEE IERYWIMRNS DGFAEKRRQL HHSSSSHNNT KPHRPRFSTY PS* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Thhalv10015741m |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF188211 | 1e-127 | KF188211.1 Brassica villosa BVTRY-1 (BVTRY-1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006401729.2 | 7e-77 | transcription factor TRY | ||||
Swissprot | Q8GV05 | 3e-67 | TRY_ARATH; Transcription factor TRY | ||||
TrEMBL | V4LL44 | 1e-123 | V4LL44_EUTSA; Uncharacterized protein (Fragment) | ||||
STRING | XP_006401729.1 | 1e-124 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM323 | 28 | 194 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G53200.1 | 1e-68 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thhalv10015741m |
Entrez Gene | 18017873 |