PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thhalv10009656m | ||||||||
Common Name | EUTSA_v10009656mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
Family | Nin-like | ||||||||
Protein Properties | Length: 88aa MW: 10266.2 Da PI: 12.0095 | ||||||||
Description | Nin-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | RWP-RK | 68.7 | 8.7e-22 | 2 | 41 | 13 | 52 |
RWP-RK 13 yFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 +F+lpik+A++ L +c+TvLK+iCR+ G++RWPhR++ksl Thhalv10009656m 2 HFHLPIKQASRRLSLCPTVLKKICRRGGLNRWPHRRVKSL 41 8*************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51519 | 15.562 | 1 | 61 | IPR003035 | RWP-RK domain |
Pfam | PF02042 | 1.1E-18 | 2 | 41 | IPR003035 | RWP-RK domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 88 aa Download sequence Send to blast |
MHFHLPIKQA SRRLSLCPTV LKKICRRGGL NRWPHRRVKS LLSKFNSLKE VLRTATDPRV 60 RMRAEQELAR LEKRLSEICS GILRNYT* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Thhalv10009656m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006400142.1 | 1e-51 | uncharacterized protein LOC18017367 | ||||
TrEMBL | V4KWH4 | 3e-56 | V4KWH4_EUTSA; Uncharacterized protein | ||||
STRING | XP_006416039.1 | 6e-57 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4076 | 23 | 42 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G66990.1 | 4e-13 | RWP-RK domain-containing protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thhalv10009656m |
Entrez Gene | 18992567 |