PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thhalv10009233m | ||||||||
Common Name | EUTSA_v10009233mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 84aa MW: 9783.17 Da PI: 7.5192 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 34.8 | 3.8e-11 | 33 | 72 | 3 | 44 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 ++T+eE++l+ + k+ G + W++Ia +++ gRt++++ +w Thhalv10009233m 33 AMTQEEEDLICRMYKLIGER-WELIAGRIP-GRTAYEIERFW 72 68******************.*********.*********99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 2.7E-6 | 30 | 78 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.14E-5 | 33 | 72 | No hit | No description |
Pfam | PF00249 | 5.4E-9 | 33 | 73 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 4.68E-8 | 34 | 73 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 2.6E-11 | 35 | 73 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 6.214 | 35 | 72 | IPR017877 | Myb-like domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0080147 | Biological Process | root hair cell development | ||||
GO:1900033 | Biological Process | negative regulation of trichome patterning | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 84 aa Download sequence Send to blast |
MDKQRKSKHP KTSATIVAST SEEVSSLEWE EVAMTQEEED LICRMYKLIG ERWELIAGRI 60 PGRTAYEIER FWVMKNHGRS QLR* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Thhalv10009233m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519518 | 2e-93 | AY519518.1 Arabidopsis thaliana MYB transcription factor (At1g01380) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006418418.1 | 1e-55 | MYB-like transcription factor ETC1 | ||||
Swissprot | Q9LNI5 | 5e-37 | ETC1_ARATH; MYB-like transcription factor ETC1 | ||||
TrEMBL | V4MWM4 | 3e-54 | V4MWM4_EUTSA; Uncharacterized protein | ||||
STRING | XP_006418418.1 | 5e-55 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM323 | 28 | 194 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G01380.1 | 8e-39 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thhalv10009233m |
Entrez Gene | 18994669 |