PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thhalv10005029m | ||||||||
Common Name | EUTSA_v10005029mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 169aa MW: 18880.8 Da PI: 6.7899 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 101.1 | 6.8e-32 | 107 | 165 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K+vk+s++pr+Y++C+ gCpvkk+ver+++dp++v++tYeg+Hnh+ Thhalv10005029m 107 LDDGFKWRKYGKKMVKNSPNPRNYFKCSVDGCPVKKRVERDRDDPSFVITTYEGSHNHS 165 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 6.2E-34 | 93 | 166 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 4.32E-28 | 100 | 165 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.608 | 102 | 167 | IPR003657 | WRKY domain |
SMART | SM00774 | 3.9E-37 | 107 | 166 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.9E-25 | 108 | 164 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 169 aa Download sequence Send to blast |
MNDAETNLAR SSSDDTHTGF KLPELYLSDE WMDDDLVSAV TGMNHSYGDD AAAFFSGSSS 60 CFSHHESPST NASPPAASTV QENQIKKEKK KVKERVAFKT RSEVEVLDDG FKWRKYGKKM 120 VKNSPNPRNY FKCSVDGCPV KKRVERDRDD PSFVITTYEG SHNHSSMN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-26 | 97 | 164 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 3e-26 | 97 | 164 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00531 | DAP | Transfer from AT5G26170 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Thhalv10005029m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY071847 | 1e-131 | AY071847.1 Arabidopsis thaliana WRKY transcription factor 50 (WRKY50) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006394862.1 | 1e-124 | probable WRKY transcription factor 50 | ||||
Swissprot | Q8VWQ5 | 2e-88 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | V4KXM5 | 1e-122 | V4KXM5_EUTSA; Uncharacterized protein | ||||
STRING | XP_006394862.1 | 1e-123 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6121 | 27 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 1e-73 | WRKY DNA-binding protein 50 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thhalv10005029m |
Entrez Gene | 18013336 |
Publications ? help Back to Top | |||
---|---|---|---|
|