PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010942236.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 155aa MW: 17816 Da PI: 8.7177 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 45.8 | 1.3e-14 | 64 | 122 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 +r rr+++NRe+ArrsR RK+ ++eL+ v L a N++L++e+++ +e ++ +e+ XP_010942236.1 64 RRKRRMISNRESARRSRMRKQRHLDELRSQVVYLRATNRRLIDEINQVMEERDRILQEN 122 699*************************************************9999987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 8.9E-15 | 60 | 124 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.105 | 62 | 118 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 9.1E-12 | 64 | 117 | No hit | No description |
Pfam | PF00170 | 3.1E-12 | 64 | 122 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 2.39E-12 | 64 | 114 | No hit | No description |
CDD | cd14702 | 1.54E-15 | 65 | 116 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 67 | 82 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 155 aa Download sequence Send to blast |
MYPHEVAGLQ YGGQLDLLRF FGVYASQVQA MCSVDGVCLP SSGPGNNSTS DEADKHQASL 60 VHERRKRRMI SNRESARRSR MRKQRHLDEL RSQVVYLRAT NRRLIDEINQ VMEERDRILQ 120 ENSWLREEAS DLQKKLDDMQ VKSTTSAAPR APDEA |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 76 | 83 | RRSRMRKQ |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00389 | DAP | Transfer from AT3G30530 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010942236.1 | 1e-112 | basic leucine zipper 43 | ||||
TrEMBL | A0A2H3YEF9 | 1e-74 | A0A2H3YEF9_PHODC; bZIP transcription factor RISBZ5-like | ||||
STRING | XP_008797570.1 | 4e-57 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1186 | 35 | 126 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G30530.1 | 6e-37 | basic leucine-zipper 42 |