PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010912590.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 199aa MW: 22759.6 Da PI: 5.5723 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 122.5 | 3.7e-38 | 8 | 125 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 lppGf+F P+d+elvv++L++k+++ +++ ++i+++d+ +++PwdL+ k+ ++ k wyfF++r +nr t++gyWk t +++++s XP_010912590.1 8 LPPGFHFFPSDQELVVHFLHRKAARLPCQP-DIIPTIDLRYCDPWDLNGKAFQGGKYWYFFTHRV--------QNRETANGYWKPTDMEESITS- 92 79*************************999.99**************976667899******985........58999****************. PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 ++ +vglk+tL+fy g+ p+g kt+Wvmhey+l XP_010912590.1 93 GDIDVGLKRTLIFYVGEPPEGMKTNWVMHEYHL 125 999****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.53E-48 | 5 | 164 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 42.984 | 8 | 165 | IPR003441 | NAC domain |
Pfam | PF02365 | 6.4E-24 | 9 | 125 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 199 aa Download sequence Send to blast |
MGEGTTNLPP GFHFFPSDQE LVVHFLHRKA ARLPCQPDII PTIDLRYCDP WDLNGKAFQG 60 GKYWYFFTHR VQNRETANGY WKPTDMEESI TSGDIDVGLK RTLIFYVGEP PEGMKTNWVM 120 HEYHLLDGVL SSASSSGGSS RRSLKKRSNT RMEPNKWIIC RVYESSCASQ NFHDDGLELS 180 CLDEVFLSFD DLDEVSLPK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 7e-38 | 7 | 171 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 7e-38 | 7 | 171 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 7e-38 | 7 | 171 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 7e-38 | 7 | 171 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 8e-38 | 7 | 171 | 19 | 174 | NAC domain-containing protein 19 |
3swm_B | 8e-38 | 7 | 171 | 19 | 174 | NAC domain-containing protein 19 |
3swm_C | 8e-38 | 7 | 171 | 19 | 174 | NAC domain-containing protein 19 |
3swm_D | 8e-38 | 7 | 171 | 19 | 174 | NAC domain-containing protein 19 |
3swp_A | 8e-38 | 7 | 171 | 19 | 174 | NAC domain-containing protein 19 |
3swp_B | 8e-38 | 7 | 171 | 19 | 174 | NAC domain-containing protein 19 |
3swp_C | 8e-38 | 7 | 171 | 19 | 174 | NAC domain-containing protein 19 |
3swp_D | 8e-38 | 7 | 171 | 19 | 174 | NAC domain-containing protein 19 |
4dul_A | 7e-38 | 7 | 171 | 16 | 171 | NAC domain-containing protein 19 |
4dul_B | 7e-38 | 7 | 171 | 16 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010912590.1 | 1e-150 | NAC domain-containing protein 104 | ||||
Swissprot | Q8GWK6 | 4e-63 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | A0A2H3YIL9 | 1e-124 | A0A2H3YIL9_PHODC; NAC domain-containing protein 104-like | ||||
STRING | XP_008799070.1 | 1e-125 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3667 | 36 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 7e-64 | xylem NAC domain 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|