PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010912244.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
|
||||||||
Family | Nin-like | ||||||||
Protein Properties | Length: 113aa MW: 13470.9 Da PI: 11.0523 | ||||||||
Description | Nin-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | RWP-RK | 69.5 | 4.7e-22 | 1 | 37 | 16 | 52 |
RWP-RK 16 lpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 +pi+ AAke++v+lT+LKr+CR++GI+RWPhRkiksl XP_010912244.1 1 MPITRAAKEMNVGLTLLKRRCRELGIPRWPHRKIKSL 37 79*********************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF02042 | 9.7E-18 | 1 | 37 | IPR003035 | RWP-RK domain |
PROSITE profile | PS51519 | 15.812 | 1 | 59 | IPR003035 | RWP-RK domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 113 aa Download sequence Send to blast |
MPITRAAKEM NVGLTLLKRR CRELGIPRWP HRKIKSLRAL IHNVQELGKG PNRESIRREL 60 ETLEEHRRLM EENPLIELTE GTKKLRQACF KAHFKKRRAL QKHCFDLSNK YYA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010912244.2 | 1e-76 | protein RKD4 | ||||
Swissprot | Q9LVU8 | 1e-35 | RKD4_ARATH; Protein RKD4 | ||||
TrEMBL | A0A2H3ZY12 | 1e-62 | A0A2H3ZY12_PHODC; protein RKD1-like | ||||
STRING | XP_008807243.1 | 7e-57 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP4590 | 33 | 65 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G53040.1 | 2e-29 | RWP-RK domain-containing protein |
Publications ? help Back to Top | |||
---|---|---|---|
|