PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.K00332.1.p | ||||||||
Common Name | EUGRSUZ_K00332, LOC104424480 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 97aa MW: 11367.9 Da PI: 10.5449 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 26.3 | 1.7e-08 | 33 | 71 | 4 | 44 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 +T++E++l+ + +++ G + W++Ia +++ gR++ ++ +w Eucgr.K00332.1.p 33 MTEQEEDLIHRMHRLVGEK-WDLIAGRIP-GRSAAEIERFW 71 69*****************.*********.********999 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 4.9E-6 | 29 | 77 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.6E-8 | 33 | 72 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.31E-6 | 33 | 71 | No hit | No description |
SuperFamily | SSF46689 | 1.48E-7 | 34 | 76 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 7.1E-11 | 34 | 72 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 97 aa Download sequence Send to blast |
MEAPGKSHRR QGRIARPSDS EEVSSTEWED IDMTEQEEDL IHRMHRLVGE KWDLIAGRIP 60 GRSAAEIERF WIMKHRKGFA ERRRERKKAK PGTFIK* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.K00332.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010035221.1 | 2e-63 | PREDICTED: MYB-like transcription factor ETC3 | ||||
Swissprot | Q8GV05 | 2e-30 | TRY_ARATH; Transcription factor TRY | ||||
TrEMBL | A0A058ZXN0 | 5e-62 | A0A058ZXN0_EUCGR; Uncharacterized protein | ||||
STRING | XP_010035221.1 | 9e-63 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM323 | 28 | 194 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G53200.1 | 9e-30 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.K00332.1.p |
Entrez Gene | 104424480 |