PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Eucgr.K00201.6.p

Common Name

EUGRSUZ_K00201

Organism

Eucalyptus grandis

Taxonomic ID

71139

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

M-type_MADS

Protein Properties

Length: 119aa MW: 13582.6 Da PI: 11.0866

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Eucgr.K00201.6.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	75.3	4.8e-24	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rien++ +qvtfskR +g+lKK +ELSvL +a+vaviifs++g+l+e+ss Eucgr.K00201.6.p 10 RIENTTSQQVTFSKRWTGLLKKVYELSVLGNAKVAVIIFSQKGRLHEFSS 59 8***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	3.1E-31	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	27.263	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.92E-32	2	70	No hit	No description
SuperFamily	SSF55455	2.49E-26	3	76	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.4E-24	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.8E-21	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.4E-24	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.4E-24	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 119 aa Download sequence Send to blast
MARGKVQMRR IENTTSQQVT FSKRWTGLLK KVYELSVLGN AKVAVIIFSQ KGRLHEFSSN 60 SKIRKTIDRY CRSTNDAATY QANMEQYILE AIRTMSWILL NRRNPTDGGS ARAKSEQH*

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Eucgr.K00201.6.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018720707.1	3e-55	PREDICTED: MADS-box protein AGL42-like
Swissprot	Q2QW53	3e-29	MAD13_ORYSJ; MADS-box transcription factor 13
TrEMBL	A0A058ZWZ9	1e-82	A0A058ZWZ9_EUCGR; Uncharacterized protein
STRING	XP_010035070.1	3e-48	(Eucalyptus grandis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G45660.1	9e-30	AGAMOUS-like 20

Link Out ? help Back to Top
Phytozome	Eucgr.K00201.6.p

Publications ? help Back to Top
Gindullis F,Rose A,Patel S,Meier I Four signature motifs define the first class of structurally related large coiled-coil proteins in plants. BMC Genomics, 2002. 3: p. 9 [PMID:11972898] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Yamaki S,Satoh H,Nagato Y Gypsy embryo specifies ovule curvature by regulating ovule/integument development in rice. Planta, 2005. 222(3): p. 408-17 [PMID:16001259] Dreni L, et al. The D-lineage MADS-box gene OsMADS13 controls ovule identity in rice. Plant J., 2007. 52(4): p. 690-9 [PMID:17877710] Yamaki S,Nagato Y,Kurata N,Nonomura K Ovule is a lateral organ finally differentiated from the terminating floral meristem in rice. Dev. Biol., 2011. 351(1): p. 208-16 [PMID:21146515] Li H,Liang W,Yin C,Zhu L,Zhang D Genetic interaction of OsMADS3, DROOPING LEAF, and OsMADS13 in specifying rice floral organ identities and meristem determinacy. Plant Physiol., 2011. 156(1): p. 263-74 [PMID:21444646] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949]