PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.J00587.6.p | ||||||||
Common Name | EUGRSUZ_J00587, LOC104421368 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 159aa MW: 17336.3 Da PI: 10.3632 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 174.8 | 5.4e-54 | 1 | 130 | 34 | 170 |
YABBY 34 vvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklsenedeevprvppvirPPekrqrvP 126 +vtvrCGhC +llsvn+a a+q + + + +++ e++ + + +s ++++s++ ss+ e + e+pr+ p irPPekrqrvP Eucgr.J00587.6.p 1 MVTVRCGHCGNLLSVNMAGAVQSAPLPDT--SQKQQPSSENMARGSGS-SSSSRPNNNTSNKFSSF---EPIEAEAPRMTP-IRPPEKRQRVP 86 69*******************99999996..33333444444443333.33334444444555543...467889999999.9********** PP YABBY 127 saynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 saynrfikeeiqrikasnPdishreafs+aaknWahfP+ihfgl Eucgr.J00587.6.p 87 SAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGL 130 ******************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 5.9E-54 | 1 | 130 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 8.12E-9 | 71 | 123 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 2.6E-5 | 78 | 124 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development | ||||
GO:0010158 | Biological Process | abaxial cell fate specification |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 159 aa Download sequence Send to blast |
MVTVRCGHCG NLLSVNMAGA VQSAPLPDTS QKQQPSSENM ARGSGSSSSS RPNNNTSNKF 60 SSFEPIEAEA PRMTPIRPPE KRQRVPSAYN RFIKEEIQRI KASNPDISHR EAFSTAAKNW 120 AHFPHIHFGL KLDGNKQGKA DQAIAGDHQG THKSHGFY* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the abaxial cell fate determination during embryogenesis and organogenesis. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.J00587.6.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FJ694015 | 2e-61 | FJ694015.1 Dimocarpus longan YAB2-2 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010031584.1 | 1e-116 | PREDICTED: putative axial regulator YABBY 2 isoform X1 | ||||
Refseq | XP_018720022.1 | 1e-116 | PREDICTED: putative axial regulator YABBY 2 isoform X1 | ||||
Swissprot | Q9XFB0 | 3e-63 | YAB2_ARATH; Putative axial regulator YABBY 2 | ||||
TrEMBL | A0A059AA64 | 1e-114 | A0A059AA64_EUCGR; Uncharacterized protein | ||||
STRING | XP_010031584.1 | 1e-115 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08465.1 | 5e-60 | YABBY family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.J00587.6.p |
Entrez Gene | 104421368 |
Publications ? help Back to Top | |||
---|---|---|---|
|