PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.I02695.1.p | ||||||||
Common Name | EUGRSUZ_I02695, LOC104419933 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 193aa MW: 21859.3 Da PI: 4.6944 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 122.5 | 3.6e-38 | 8 | 125 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 lppGfrF Ptdeelvv++L++k++ +++ +vi+++++y ++Pw+L+ k+ +e ++wyfFs++ + r+t +gyWk g ++v+ Eucgr.I02695.1.p 8 LPPGFRFYPTDEELVVHFLQRKAALLPCHP-DVIPDLELYPYDPWELEGKALSEGNKWYFFSRK--------TPDRITGNGYWKPMGD-EPVF 90 79*************************999.99***************77778899*****997........4689**********98.6777 PP NAM 94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128 +++++ vg+k++Lv+y g+ap g++t+W+mheyrl Eucgr.I02695.1.p 91 TSSSKRVGMKQSLVYYLGEAPGGTRTNWIMHEYRL 125 77999****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.14E-48 | 5 | 158 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 45.631 | 8 | 160 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.6E-24 | 9 | 125 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0043067 | Biological Process | regulation of programmed cell death | ||||
GO:0048367 | Biological Process | shoot system development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 193 aa Download sequence Send to blast |
MGDNNVNLPP GFRFYPTDEE LVVHFLQRKA ALLPCHPDVI PDLELYPYDP WELEGKALSE 60 GNKWYFFSRK TPDRITGNGY WKPMGDEPVF TSSSKRVGMK QSLVYYLGEA PGGTRTNWIM 120 HEYRLSNGTN SGSSSSRSSK RKGYPKIDYS KWVVCRVYEH GDDDNDDNGA ELSCLDEVFL 180 SLDDLDEIST PN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-46 | 4 | 159 | 13 | 164 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-46 | 4 | 159 | 13 | 164 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-46 | 4 | 159 | 13 | 164 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-46 | 4 | 159 | 13 | 164 | NO APICAL MERISTEM PROTEIN |
3swm_A | 4e-46 | 4 | 160 | 16 | 168 | NAC domain-containing protein 19 |
3swm_B | 4e-46 | 4 | 160 | 16 | 168 | NAC domain-containing protein 19 |
3swm_C | 4e-46 | 4 | 160 | 16 | 168 | NAC domain-containing protein 19 |
3swm_D | 4e-46 | 4 | 160 | 16 | 168 | NAC domain-containing protein 19 |
3swp_A | 4e-46 | 4 | 160 | 16 | 168 | NAC domain-containing protein 19 |
3swp_B | 4e-46 | 4 | 160 | 16 | 168 | NAC domain-containing protein 19 |
3swp_C | 4e-46 | 4 | 160 | 16 | 168 | NAC domain-containing protein 19 |
3swp_D | 4e-46 | 4 | 160 | 16 | 168 | NAC domain-containing protein 19 |
4dul_A | 4e-46 | 4 | 159 | 13 | 164 | NAC domain-containing protein 19 |
4dul_B | 4e-46 | 4 | 159 | 13 | 164 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.I02695.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010030072.1 | 1e-142 | PREDICTED: NAC domain-containing protein 104 | ||||
Swissprot | Q8GWK6 | 9e-78 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | A0A059ASW0 | 1e-140 | A0A059ASW0_EUCGR; Uncharacterized protein | ||||
STRING | XP_010030072.1 | 1e-141 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3674 | 28 | 62 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 1e-78 | xylem NAC domain 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.I02695.1.p |
Entrez Gene | 104419933 |
Publications ? help Back to Top | |||
---|---|---|---|
|