PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.I00556.1.p | ||||||||
Common Name | EUGRSUZ_I00556, LOC104418331 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 228aa MW: 25398.7 Da PI: 6.1665 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 88.8 | 3e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i n + rqvtfskRr g++KKAeELSvLCda+va+i+fss+gkl+ey+s Eucgr.I00556.1.p 9 KKITNATARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSSGKLFEYCS 59 689**********************************************96 PP | |||||||
2 | K-box | 52.6 | 2e-18 | 93 | 173 | 20 | 100 |
K-box 20 elakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 ++++L ke+ + +++R++ Ge+L+ L++ eLqqLe+ Le +l+++ +kK e ++++i +lq+k +l eenk+L++++ e Eucgr.I00556.1.p 93 DYSRLSKEVAEKGHQLRQMRGEELQGLNIDELQQLEKSLEAGLNRVIEKKGEKIVKEITDLQQKGAKLMEENKRLKQQVTE 173 68899999999999***************************************************************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.871 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 4.2E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.21E-40 | 2 | 75 | No hit | No description |
PRINTS | PR00404 | 2.5E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.24E-32 | 3 | 79 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.5E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.5E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.5E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.032 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 2.2E-16 | 93 | 171 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009266 | Biological Process | response to temperature stimulus | ||||
GO:0009910 | Biological Process | negative regulation of flower development | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0048438 | Biological Process | floral whorl development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000900 | Molecular Function | translation repressor activity, nucleic acid binding | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 228 aa Download sequence Send to blast |
MAREKIQIKK ITNATARQVT FSKRRRGLFK KAEELSVLCD ADVALIVFSS SGKLFEYCSS 60 SMKEILERHH SHSENLGKLD QPSLELQLVE NGDYSRLSKE VAEKGHQLRQ MRGEELQGLN 120 IDELQQLEKS LEAGLNRVIE KKGEKIVKEI TDLQQKGAKL MEENKRLKQQ VTEISGRKTT 180 ATDSETIINE EGLSSESVTN VCSSSSGPPQ EDDSSDFSLK LGLPYNG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 6e-22 | 1 | 74 | 1 | 74 | MEF2 CHIMERA |
6byy_B | 6e-22 | 1 | 74 | 1 | 74 | MEF2 CHIMERA |
6byy_C | 6e-22 | 1 | 74 | 1 | 74 | MEF2 CHIMERA |
6byy_D | 6e-22 | 1 | 74 | 1 | 74 | MEF2 CHIMERA |
6bz1_A | 6e-22 | 1 | 74 | 1 | 74 | MEF2 CHIMERA |
6bz1_B | 6e-22 | 1 | 74 | 1 | 74 | MEF2 CHIMERA |
6bz1_C | 6e-22 | 1 | 74 | 1 | 74 | MEF2 CHIMERA |
6bz1_D | 6e-22 | 1 | 74 | 1 | 74 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00272 | DAP | Transfer from AT2G22540 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.I00556.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY273873 | 0.0 | AY273873.1 Eucalyptus occidentalis SVP-like floral repressor mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010027953.1 | 1e-164 | PREDICTED: MADS-box protein JOINTLESS isoform X1 | ||||
Refseq | XP_018717707.1 | 1e-164 | PREDICTED: MADS-box protein JOINTLESS isoform X1 | ||||
Refseq | XP_018717708.1 | 1e-164 | PREDICTED: MADS-box protein JOINTLESS isoform X1 | ||||
Swissprot | Q9FUY6 | 1e-109 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
TrEMBL | A0A059AKT4 | 1e-163 | A0A059AKT4_EUCGR; Uncharacterized protein | ||||
STRING | XP_010027952.1 | 1e-163 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4190 | 27 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 8e-95 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.I00556.1.p |
Entrez Gene | 104418331 |
Publications ? help Back to Top | |||
---|---|---|---|
|