PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Eucgr.H01753.1.p

Common Name

EUGRSUZ_H01753

Organism

Eucalyptus grandis

Taxonomic ID

71139

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

MYB_related

Protein Properties

Length: 74aa MW: 8456.45 Da PI: 10.4633

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Eucgr.H01753.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	36.8	9.3e-12	2	46	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++ + ++ +g+W+ I+r + k+Rt+ q+ s+ qky Eucgr.H01753.1.p 2 PWTEEEHGLFLLGLQKGAKGDWRGISRNFVKTRTPVQVASHAQKY 46 8*******************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
TIGRFAMs	TIGR01557	8.8E-14	1	49	IPR006447	Myb domain, plants
PROSITE profile	PS51294	14.072	1	51	IPR017930	Myb domain
SuperFamily	SSF46689	5.44E-15	2	52	IPR009057	Homeodomain-like
Pfam	PF00249	1.5E-8	2	46	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.0E-9	2	46	IPR009057	Homeodomain-like
CDD	cd00167	9.80E-6	2	47	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 74 aa Download sequence Send to blast
VPWTEEEHGL FLLGLQKGAK GDWRGISRNF VKTRTPVQVA SHAQKYFIQL SNQNGRRWRS 60 SLFDITTDSE TQH*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor (PubMed:23888064, PubMed:24806884). Direct regulator of the transcription of peroxidase (Prxs) and reactive oxygen species (ROS)-related genes via the recognition of 5'-ATCACA-3' motif (PubMed:24806884). Binds to 5'-TATCCA-3' motif (TA box) and represses the activity of corresponding promoters (e.g. sugar response genes) (PubMed:25920996). Regulates hypocotyl elongation in response to darkness by enhancing auxin accumulation in a phytochrome-interacting factor (PIF) proteins-dependent manner. Promotes lateral roots formation (PubMed:23888064). Promotes cell expansion during leaves development via the modulation of cell wall-located Prxs (PubMed:24806884). Plays a critical role in developmentally regulated and dark-induced onset of leaf senescence by repressing the transcription of several genes involved in chloroplast function and responses to light and auxin. Promotes responses to auxin, abscisic acid (ABA), and ethylene (PubMed:25920996). {ECO:0000269\|PubMed:23888064, ECO:0000269\|PubMed:24806884, ECO:0000269\|PubMed:25920996}.
UniProt	Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269\|PubMed:12172034, ECO:0000269\|PubMed:20130099}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Eucgr.H01753.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269\|PubMed:12172034, ECO:0000269\|PubMed:20130099}.
UniProt	INDUCTION: Slightly induced by CdCl(2) (PubMed:16463103). Accumulates in the dark (PubMed:23888064, PubMed:25920996). Diurnal expression pattern with maximal levels in the morning (at protein level). Specifically induced during leaf expansion (PubMed:24806884). Expressed in old and dark-treated leaves (PubMed:25920996). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:23888064, ECO:0000269\|PubMed:24806884, ECO:0000269\|PubMed:25920996}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018715804.1	8e-44	PREDICTED: TMV resistance protein N
Swissprot	Q7XC57	3e-29	MYBS3_ORYSJ; Transcription factor MYBS3
Swissprot	Q9LVS0	4e-29	KUA1_ARATH; Transcription factor KUA1
TrEMBL	A0A059AZQ7	3e-47	A0A059AZQ7_EUCGR; Uncharacterized protein (Fragment)
STRING	XP_010026324.1	3e-43	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM20477	5	5

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G47390.1	2e-31	MYB_related family protein

Link Out ? help Back to Top
Phytozome	Eucgr.H01753.1.p

Publications ? help Back to Top
Rice Chromosome 10 Sequencing Consortium In-depth view of structure, activity, and evolution of rice chromosome 10. Science, 2003. 300(5625): p. 1566-9 [PMID:12791992] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Su CF, et al. A novel MYBS3-dependent pathway confers cold tolerance in rice. Plant Physiol., 2010. 153(1): p. 145-58 [PMID:20130099] Liu C,Wang B,Li Z,Peng Z,Zhang J TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth. Plant Physiol., 2018. 176(1): p. 742-756 [PMID:29122985]