PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Eucgr.G02519.1.p

Common Name

EUGRSUZ_G02519, LOC104453965

Organism

Eucalyptus grandis

Taxonomic ID

71139

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

bHLH

Protein Properties

Length: 95aa MW: 10511.8 Da PI: 7.5225

Description

bHLH family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Eucgr.G02519.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HLH	28.6	2.6e-09	22	61	15	54
HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 +i + +++Lr+l+P++ ++ K+s + L+++++YI+sL Eucgr.G02519.1.p 22 QISDLLSKLRQLIPQLRTNHTDKVSASKLLQETCNYIRSL 61 899**********76888899*************99 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50888	10.48	7	61	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamily	SSF47459	4.32E-10	21	78	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
Gene3D	G3DSA:4.10.280.10	5.4E-9	22	79	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
Pfam	PF00010	1.1E-6	22	61	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 95 aa Download sequence Send to blast
MSTRRASRSS QPSSVAGMSD EQISDLLSKL RQLIPQLRTN HTDKVSASKL LQETCNYIRS 60 LHREVDDLSD QLSQLLASTD RDSDQAAIIR SLLL*

Functional Description ? help Back to Top
Source	Description
UniProt	Atypical and probable non DNA-binding bHLH transcription factor that regulates light-mediated responses in day light conditions by binding and inhibiting the activity of the bHLH transcription factor HFR1, a critical regulator of light signaling and shade avoidance. Forms non-functional heterodimers with HFR1, causing liberation and activation of PIF4 from the transcriptionally inactive HFR1-PIF4 complex. {ECO:0000269\|PubMed:16786307, ECO:0000269\|PubMed:23224238}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Eucgr.G02519.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian regulation with a peak of expression at midday. {ECO:0000269\|PubMed:16786307}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010066932.1	3e-59	PREDICTED: transcription factor PRE6
Swissprot	Q8GW32	1e-32	PRE6_ARATH; Transcription factor PRE6
TrEMBL	A0A059BFK1	7e-58	A0A059BFK1_EUCGR; Uncharacterized protein
STRING	XP_010066932.1	1e-58	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM259	28	225

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G26945.1	8e-27	bHLH family protein

Link Out ? help Back to Top
Phytozome	Eucgr.G02519.1.p
Entrez Gene	104453965

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Gommers CM, et al. Molecular Profiles of Contrasting Shade Response Strategies in Wild Plants: Differential Control of Immunity and Shoot Elongation. Plant Cell, 2017. 29(2): p. 331-344 [PMID:28138015] Sanz-Fernández M, et al. Screening Arabidopsis mutants in genes useful for phytoremediation. J. Hazard. Mater., 2017. 335: p. 143-151 [PMID:28441590] Zheng K, et al. Involvement of PACLOBUTRAZOL RESISTANCE6/KIDARI, an Atypical bHLH Transcription Factor, in Auxin Responses in Arabidopsis. Front Plant Sci, 2017. 8: p. 1813 [PMID:29114256]