PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.F02141.2.p | ||||||||
Common Name | EUGRSUZ_F02141 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 161aa MW: 18579.4 Da PI: 9.0618 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 85.9 | 2.3e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n + rqvtfskRr g++KKAeELSvLCda+v++i+fs tgkly++ss Eucgr.F02141.2.p 9 KKIDNLTARQVTFSKRRRGLIKKAEELSVLCDADVSLIVFSATGKLYDFSS 59 68***********************************************96 PP | |||||||
2 | K-box | 43.4 | 1.4e-15 | 100 | 158 | 27 | 85 |
K-box 27 eienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85 e+ +++R+++GedLe L+++eL qLe++Le +l+ + + K+e ++i++lq+k + Eucgr.F02141.2.p 100 EVYDRAHKLRQMKGEDLEGLNVEELDQLEKKLEAGLSLVIKNKEEKTWNEINKLQRKVH 158 444445789***********************************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.1E-36 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 29.072 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.5E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.09E-30 | 3 | 85 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.8E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.20E-31 | 12 | 75 | No hit | No description |
PRINTS | PR00404 | 4.5E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.5E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 9.794 | 87 | 160 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.6E-11 | 95 | 158 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 161 aa Download sequence Send to blast |
MAKEKIKIKK IDNLTARQVT FSKRRRGLIK KAEELSVLCD ADVSLIVFSA TGKLYDFSSS 60 RMEDTLTRYY GFHSNKVEKS VQPCLALEIE NTNREMLHEE VYDRAHKLRQ MKGEDLEGLN 120 VEELDQLEKK LEAGLSLVIK NKEEKTWNEI NKLQRKVHAP * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 8e-18 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 8e-18 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 8e-18 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 8e-18 | 1 | 69 | 1 | 69 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.F02141.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010061528.1 | 1e-112 | PREDICTED: MADS-box protein JOINTLESS isoform X3 | ||||
Swissprot | Q9FUY6 | 4e-61 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
TrEMBL | A0A059BRD2 | 1e-113 | A0A059BRD2_EUCGR; Uncharacterized protein | ||||
STRING | XP_010061527.1 | 1e-110 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 1e-61 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.F02141.2.p |
Publications ? help Back to Top | |||
---|---|---|---|
|