PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Eucgr.D02326.1.p

Common Name

EUGRSUZ_D02326

Organism

Eucalyptus grandis

Taxonomic ID

71139

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

WRKY

Protein Properties

Length: 124aa MW: 14350.3 Da PI: 10.591

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Eucgr.D02326.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	104.1	7.4e-33	40	98	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYGqK vk+s++prsYYrC++ C+vkk+v+r +ed+++v++tYeg Hnh+ Eucgr.D02326.1.p 40 LDDGFRWRKYGQKAVKNSTHPRSYYRCAHIACNVKKQVQRLSEDTSIVVTTYEGIHNHP 98 59********************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	1.0E-33	27	99	IPR003657	WRKY domain
SuperFamily	SSF118290	3.92E-29	32	99	IPR003657	WRKY domain
PROSITE profile	PS50811	28.449	35	100	IPR003657	WRKY domain
SMART	SM00774	2.2E-38	40	99	IPR003657	WRKY domain
Pfam	PF03106	2.6E-26	41	98	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 124 aa Download sequence Send to blast
MEEIRARRLE KRSKAAASSR ARKAASPRFE FQTRSEDDLL DDGFRWRKYG QKAVKNSTHP 60 RSYYRCAHIA CNVKKQVQRL SEDTSIVVTT YEGIHNHPSE KIMETLSPLL RQIQLLSRFS 120 PDK*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	2e-26	31	97	8	74	Probable WRKY transcription factor 4
2lex_A	2e-26	31	97	8	74	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Eucgr.D02326.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010053764.1	3e-87	PREDICTED: probable WRKY transcription factor 75
Swissprot	Q8GY11	5e-52	WRK43_ARATH; Probable WRKY transcription factor 43
Swissprot	Q8VWQ4	4e-51	WRK56_ARATH; Probable WRKY transcription factor 56
Swissprot	Q9FFS3	2e-51	WRK24_ARATH; Probable WRKY transcription factor 24
TrEMBL	A0A059CI98	1e-86	A0A059CI98_EUCGR; Uncharacterized protein
STRING	XP_010053764.1	1e-86	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM509	28	154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G64000.1	2e-51	WRKY DNA-binding protein 56

Link Out ? help Back to Top
Phytozome	Eucgr.D02326.1.p

Publications ? help Back to Top
Geilen K,Heilmann M,Hillmer S,Böhmer M WRKY43 regulates polyunsaturated fatty acid content and seed germination under unfavourable growth conditions. Sci Rep, 2017. 7(1): p. 14235 [PMID:29079824]