PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.B00634.2.p | ||||||||
Common Name | EUGRSUZ_B00634 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 229aa MW: 26485.2 Da PI: 9.2999 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 97.4 | 5.9e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr+g+lKKA+E+SvLCdaeva+iifs +gkl+eys+ Eucgr.B00634.2.p 9 KRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIIFSAKGKLFEYST 59 79***********************************************96 PP | |||||||
2 | K-box | 88.8 | 1e-29 | 78 | 164 | 4 | 90 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqee 90 ++ + e++ s++ e+akLk+++e L r+ Rh++GedL+sLslk+Lq+LeqqLe++lk+iRs+Kn+l++e+i+ lqkk ke +++ Eucgr.B00634.2.p 78 HQVLASETESIGSWTLEHAKLKARLEVLHRNYRHFMGEDLDSLSLKDLQNLEQQLESALKHIRSRKNQLMHESISVLQKKVKEKERA 164 4555567778899*******************************************************************9987764 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.5E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.198 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.09E-33 | 2 | 90 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.03E-43 | 2 | 79 | No hit | No description |
PRINTS | PR00404 | 9.4E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.6E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.4E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.4E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.3E-24 | 85 | 162 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.511 | 88 | 177 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010077 | Biological Process | maintenance of inflorescence meristem identity | ||||
GO:0010154 | Biological Process | fruit development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 229 aa Download sequence Send to blast |
MGRGRLQLKR IENKINRQVT FSKRRAGLLK KAHEISVLCD AEVALIIFSA KGKLFEYSTD 60 SCMERILERY ERYSYSEHQV LASETESIGS WTLEHAKLKA RLEVLHRNYR HFMGEDLDSL 120 SLKDLQNLEQ QLESALKHIR SRKNQLMHES ISVLQKKVKE KERALAQQAQ WEQQDHALDS 180 PVVLPHYLPS LDINGSYQAR HNGHDDGENL TQPRAGTLLP PWMLHRLN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6byy_A | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6c9l_A | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.B00634.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF305076 | 0.0 | AF305076.1 Eucalyptus globulus MADS-box protein EAP1 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010031068.1 | 1e-165 | PREDICTED: truncated transcription factor CAULIFLOWER A | ||||
Swissprot | Q42429 | 1e-106 | AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog | ||||
TrEMBL | A0A059D0K9 | 1e-167 | A0A059D0K9_EUCGR; Uncharacterized protein | ||||
STRING | XP_010031068.1 | 1e-164 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60910.1 | 6e-95 | AGAMOUS-like 8 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.B00634.2.p |
Publications ? help Back to Top | |||
---|---|---|---|
|