PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.A01648.1.p | ||||||||
Common Name | EUGRSUZ_A01648 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 211aa MW: 24601.9 Da PI: 7.0633 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.1 | 3.1e-16 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W ++Ede+l v+ lG ++W+ Ia+t g++R++k+c++rw +yl Eucgr.A01648.1.p 15 KGPWIEQEDEILTAFVTVLGERRWDYIAKTSGLKRSGKSCRLRWKNYL 62 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 51.5 | 2.3e-16 | 69 | 113 | 2 | 48 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g+ ++eE+ ++++ ++q+G++ W++Ia++++ gRt++++k++w ++l Eucgr.A01648.1.p 69 GPISPEEERIIIKFHEQWGNK-WSRIAEKLP-GRTDNEIKNFWKTHL 113 6789*****************.*********.***********9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.106 | 10 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.21E-27 | 13 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.2E-7 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-11 | 15 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-20 | 16 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.58E-6 | 17 | 62 | No hit | No description |
PROSITE profile | PS51294 | 25.059 | 63 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 4.2E-16 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.6E-15 | 69 | 113 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.11E-11 | 70 | 113 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.6E-24 | 70 | 117 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 211 aa Download sequence Send to blast |
MMGHRGEARE EKLRKGPWIE QEDEILTAFV TVLGERRWDY IAKTSGLKRS GKSCRLRWKN 60 YLCPNLKHGP ISPEEERIII KFHEQWGNKW SRIAEKLPGR TDNEIKNFWK THLRKKVQSS 120 KQALIGAACD DPESQMTTGS SLNVLSFSDF SHLNSPYEIR LLDWMSEFGN DANEVNCVDC 180 KHWGLCFCFP KWDFEEVDNS IWNCPGYLWE * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 3e-25 | 13 | 117 | 2 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 3e-25 | 13 | 117 | 2 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 3e-25 | 13 | 117 | 2 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00406 | DAP | Transfer from AT3G53200 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.A01648.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates in etiolated seedlings in dark conditions. {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010050632.1 | 1e-149 | PREDICTED: transcription factor MYB59 | ||||
Swissprot | Q9SCP1 | 6e-55 | MYB27_ARATH; Transcription factor MYB27 | ||||
TrEMBL | A0A059DFK9 | 1e-155 | A0A059DFK9_EUCGR; Uncharacterized protein | ||||
STRING | XP_010050632.1 | 1e-149 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM11397 | 25 | 33 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53200.1 | 3e-57 | myb domain protein 27 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.A01648.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|