PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT3G53200.1 | ||||||||
Common Name | AtMYB27, MYB27, T4D2.130 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 238aa MW: 27996.2 Da PI: 7.0501 | ||||||||
Description | myb domain protein 27 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.1 | 3e-16 | 11 | 58 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W +eEde+lv+++ +lG ++W++ a g++R++k+c++rw +yl AT3G53200.1 11 RGPWLEEEDERLVKVISLLGERRWDSLAIVSGLKRSGKSCRLRWMNYL 58 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 54.1 | 3.5e-17 | 64 | 108 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++++eE+ ++ ++++++G++ W++Iar+++ gRt++++k++w+++ AT3G53200.1 64 RGPMSQEEERIIFQLHALWGNK-WSKIARRLP-GRTDNEIKNYWRTH 108 89********************.*********.************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.661 | 6 | 58 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.76E-27 | 9 | 105 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.7E-13 | 10 | 60 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.6E-14 | 11 | 58 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.7E-19 | 12 | 65 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.48E-8 | 13 | 58 | No hit | No description |
PROSITE profile | PS51294 | 27.157 | 59 | 113 | IPR017930 | Myb domain |
SMART | SM00717 | 6.0E-17 | 63 | 111 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.9E-15 | 64 | 108 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.38E-10 | 66 | 108 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.4E-24 | 66 | 112 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 238 aa Download sequence Send to blast |
MDFKKEETLR RGPWLEEEDE RLVKVISLLG ERRWDSLAIV SGLKRSGKSC RLRWMNYLNP 60 TLKRGPMSQE EERIIFQLHA LWGNKWSKIA RRLPGRTDNE IKNYWRTHYR KKQEAQNYGK 120 LFEWRGNTGE ELLHKYKETE ITRTKTTSQE HGFVEVVSME SGKEANGGVG GRESFGVMKS 180 PYENRISDWI SEISTDQSEA NLSEDHSSNS CSENNINIGT WWFQETRDFE EFSCSLWS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 7e-29 | 9 | 112 | 2 | 104 | MYB PROTO-ONCOGENE PROTEIN |
1h88_C | 2e-28 | 9 | 112 | 56 | 158 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 2e-28 | 9 | 112 | 56 | 158 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 7e-29 | 9 | 112 | 2 | 104 | C-Myb DNA-Binding Domain |
1msf_C | 7e-29 | 9 | 112 | 2 | 104 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 251974_at | 0.0 | ||||
Expression Atlas | AT3G53200 | - | ||||
AtGenExpress | AT3G53200 | - | ||||
ATTED-II | AT3G53200 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Member of the R2R3 factor gene family. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00406 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT3G53200.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates in etiolated seedlings in dark conditions. {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT3G53200 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK117256 | 0.0 | AK117256.1 Arabidopsis thaliana At3g53200 mRNA for putative transcription factor (MYB27), complete cds, clone: RAFL16-81-D10. | |||
GenBank | AY519599 | 0.0 | AY519599.1 Arabidopsis thaliana MYB transcription factor (At3g53200) mRNA, complete cds. | |||
GenBank | BT005257 | 0.0 | BT005257.1 Arabidopsis thaliana At3g53200 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_566980.1 | 1e-175 | myb domain protein 27 | ||||
Swissprot | Q9SCP1 | 1e-176 | MYB27_ARATH; Transcription factor MYB27 | ||||
TrEMBL | A0A178VAH3 | 1e-166 | A0A178VAH3_ARATH; MYB27 | ||||
STRING | AT3G53200.1 | 1e-175 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM11397 | 25 | 33 | Representative plant | OGRP5 | 17 | 1784 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT3G53200.1 |
Entrez Gene | 824486 |
iHOP | AT3G53200 |
wikigenes | AT3G53200 |