PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcS779080.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 172aa MW: 18917.3 Da PI: 11.0215 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 105.9 | 3.5e-33 | 25 | 81 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 d p+YVNaKQy++Il+RRq+Rak+e+++kl k+rkpylheSRh hAl+R RgsgGrF EcS779080.10 25 DGPIYVNAKQYHGILRRRQSRAKMEAQNKL-VKARKPYLHESRHLHALNRVRGSGGRF 81 57****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 9.6E-37 | 23 | 84 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 36.545 | 24 | 84 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 2.9E-24 | 27 | 49 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 6.0E-28 | 27 | 81 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 2.9E-24 | 58 | 81 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010262 | Biological Process | somatic embryogenesis | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 172 aa Download sequence Send to blast |
QSQVGSQMLG MAPGRVPLPL NLADDGPIYV NAKQYHGILR RRQSRAKMEA QNKLVKARKP 60 YLHESRHLHA LNRVRGSGGR FLSTKQRQQL DPASSSHSPF ATGPRDRNKD AYEPETHQVG 120 ASERQFTSTM AGADFYPDSR FSGISTHMGG AMQCNKGLMR GGAAQHCSSS VR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 3e-22 | 25 | 87 | 2 | 64 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010047511.1 | 1e-122 | PREDICTED: nuclear transcription factor Y subunit A-3 | ||||
Refseq | XP_018725338.1 | 1e-122 | PREDICTED: nuclear transcription factor Y subunit A-3 | ||||
Swissprot | Q9LVJ7 | 4e-37 | NFYA6_ARATH; Nuclear transcription factor Y subunit A-6 | ||||
TrEMBL | A0A059CMQ5 | 1e-121 | A0A059CMQ5_EUCGR; Uncharacterized protein | ||||
STRING | XP_010047511.1 | 1e-122 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3349 | 27 | 62 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G14020.1 | 2e-39 | nuclear factor Y, subunit A6 |
Publications ? help Back to Top | |||
---|---|---|---|
|